The URL can be used to link to this page

Home My WebLink AboutDAQ-2024-005089 DAQE-AN158520002-24 {{$d1 }} Lee Ware Kilgore Companies, LLC 7057 West 2100 South Salt Lake City, UT 84128 lee.ware@kilgorecompanies.com Dear Mr. Ware: Re: Approval Order: Minor Modification to Approval Order DAQE-AN158520001-18 to Increase Production Project Number: N158520002 The attached Approval Order (AO) is issued pursuant to the Notice of Intent (NOI) received on February 2, 2022. Kilgore Companies, LLC must comply with the requirements of this AO, all applicable state requirements (R307), and Federal Standards. The project engineer for this action is Christine Bodell, who can be contacted at (385) 290-2690 or cbodell@utah.gov. Future correspondence on this AO should include the engineer's name as well as the DAQE number shown on the upper right-hand corner of this letter. Public comments were received on this action Sincerely, {{$s }} Bryce C. Bird Director BCB:CB:jg cc: Utah County Health Department DJ Law, EPA Region 8 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 536-4414 www.deq.utah.gov Printed on 100% recycled paper State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director February 14, 2024 STATE OF UTAH Department of Environmental Quality Division of Air Quality {{#s=Sig_es_:signer1:signature}} {{#d1=date1_es_:signer1:date:format(date, "mmmm d, yyyy")}} {{#d2=date1_es_:signer1:date:format(date, "mmmm d, yyyy"):align(center)}} APPROVAL ORDER DAQE-AN158520002-24 Minor Modification to Approval Order DAQE-AN158520001-18 to Increase Production Prepared By Christine Bodell, Engineer (385) 290-2690 cbodell@utah.gov Issued to Kilgore Contracting, LLC - Benjamin Aggregate & Asphalt Plant Issued On {{$d2 }} Issued By {{$s }} Bryce C. Bird Director Division of Air Quality February 14, 2024 TABLE OF CONTENTS TITLE/SIGNATURE PAGE ....................................................................................................... 1 GENERAL INFORMATION ...................................................................................................... 3 CONTACT/LOCATION INFORMATION ............................................................................... 3 SOURCE INFORMATION ........................................................................................................ 3 General Description ................................................................................................................ 3 NSR Classification .................................................................................................................. 3 Source Classification .............................................................................................................. 3 Applicable Federal Standards ................................................................................................. 3 Project Description.................................................................................................................. 4 SUMMARY OF EMISSIONS .................................................................................................... 4 SECTION I: GENERAL PROVISIONS .................................................................................... 4 SECTION II: PERMITTED EQUIPMENT .............................................................................. 5 SECTION II: SPECIAL PROVISIONS ..................................................................................... 7 PERMIT HISTORY ................................................................................................................... 15 ACRONYMS ............................................................................................................................... 16 DAQE-AN158520002-24 Page 3 GENERAL INFORMATION CONTACT/LOCATION INFORMATION Owner Name Source Name Kilgore Companies, LLC Kilgore Contracting, LLC - Benjamin Aggregate & Asphalt Plant Mailing Address Physical Address 7057 West 2100 South 7200 South 5600 West Salt Lake City, UT 84128 Benjamin, UT 84660 Source Contact UTM Coordinates Name: Lee Ware 431,360 m Easting Phone: (801) 831-7402 4,439,030 m Northing Email: lee.ware@kilgorecompanies.com Datum NAD83 UTM Zone 12 SIC code 1442 (Construction Sand & Gravel) SOURCE INFORMATION General Description Kilgore Contracting, LLC (Kilgore) operates the Benjamin Pit asphalt and aggregate processing plant in Utah County. Standard aggregate and hot mix asphalt (HMA) equipment such as crushers, screens, stockpiles, hoppers, conveyors, silos, and storage tanks are present on site. The aggregate facility utilizes line power to power on site crushers and screens. Aggregate materials are fed into crushers and screens after on-site drilling and blasting. Aggregates cycle through the crushers and screens to achieve appropriate sizing and are stored on location before being trucked off site or to the asphalt plant. The asphalt plant mixes aggregate, asphalt oil, lime, and fly ash to produce hot mix asphalt. NSR Classification Minor Modification at Minor Source Source Classification Located in Southern Wasatch Front O3 NAA, Provo UT PM2.5 NAA Utah County Airs Source Size: SM Applicable Federal Standards NSPS (Part 60), A: General Provisions NSPS (Part 60), I: Standards of Performance for Hot Mix Asphalt Facilities NSPS (Part 60), OOO: Standards of Performance for Nonmetallic Mineral Processing Plants DAQE-AN158520002-24 Page 4 Project Description Kilgore has requested modification to the Benjamin Pit AO. The source has proposed to increase processed aggregate production by 200,000 tpy for a total of 800,000 tpy and to increase HMA production by 40,000 tpy, for a total of 250,000 tpy. One (1) 40-ton fly ash silo will be added. Condition II.B.3.h was updated to reflect the updated control mechanism of water cannon and/or water truck spray to storage piles. Due to the varying heights and locations of the storage piles, spray bars were found to be technically limiting. Water cannon and/or water truck spray were found to be equally as efficient for water-based controls. No other equipment will be added or modified as a result of this change. SUMMARY OF EMISSIONS The emissions listed below are an estimate of the total potential emissions from the source. Some rounding of emissions is possible. Criteria Pollutant Change (TPY) Total (TPY) CO2 Equivalent -2199.53 3041.60 Carbon Monoxide 2.93 19.22 Nitrogen Oxides -1.97 4.44 Particulate Matter - PM10 5.99 18.79 Particulate Matter - PM2.5 2.29 7.72 Sulfur Dioxide 2.30 7.25 Volatile Organic Compounds 1.04 6.21 Hazardous Air Pollutant Change (lbs/yr) Total (lbs/yr) Acetaldehyde (CAS #75070) 53 326 Formaldehyde (CAS #50000) 126 796 Generic HAPs (CAS #GHAPS) 33 440 Hexane (CAS #110543) 36 234 Naphthalene (CAS #91203) 26 165 Toluene (CAS #108883) 112 730 Change (TPY) Total (TPY) Total HAPs 0.20 1.35 SECTION I: GENERAL PROVISIONS I.1 All definitions, terms, abbreviations, and references used in this AO conform to those used in the UAC R307 and 40 CFR. Unless noted otherwise, references cited in these AO conditions refer to those rules. [R307-101] I.2 The limits set forth in this AO shall not be exceeded without prior approval. [R307-401] I.3 Modifications to the equipment or processes approved by this AO that could affect the emissions covered by this AO must be reviewed and approved. [R307-401-1] DAQE-AN158520002-24 Page 5 I.4 All records referenced in this AO or in other applicable rules, which are required to be kept by the owner/operator, shall be made available to the Director or Director's representative upon request, and the records shall include the two-year period prior to the date of the request. Unless otherwise specified in this AO or in other applicable state and federal rules, records shall be kept for a minimum of two (2) years. [R307-401-8] I.5 At all times, including periods of startup, shutdown, and malfunction, owners and operators shall, to the extent practicable, maintain and operate any equipment approved under this AO, including associated air pollution control equipment, in a manner consistent with good air pollution control practice for minimizing emissions. Determination of whether acceptable operating and maintenance procedures are being used will be based on information available to the Director which may include, but is not limited to, monitoring results, opacity observations, review of operating and maintenance procedures, and inspection of the source. All maintenance performed on equipment authorized by this AO shall be recorded. [R307-401-4] I.6 The owner/operator shall comply with UAC R307-107. General Requirements: Breakdowns. [R307-107] I.7 The owner/operator shall comply with UAC R307-150 Series. Emission Inventories. [R307-150] I.8 The owner/operator shall submit documentation of the status of construction or modification to the Director within 18 months from the date of this AO. This AO may become invalid if construction is not commenced within 18 months from the date of this AO or if construction is discontinued for 18 months or more. To ensure proper credit when notifying the Director, send the documentation to the Director, attn.: NSR Section. [R307-401-18] SECTION II: PERMITTED EQUIPMENT II.A THE APPROVED EQUIPMENT II.A.1 Benjamin Aggregate & Asphalt Plant II.A.2 Aggregate Plant Crushing, screening, hauling, conveying, and storing II.A.3 One (1) Jaw Crusher Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.4 One (1) Cone Crusher Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.5 One (1) Vertical Shaft Impactor Crusher Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.6 Three (3) Triple Deck Screens Size: 8' x 20' Capacity: 400 TPH Each NSPS Applicability: Subpart OOO DAQE-AN158520002-24 Page 6 II.A.7 Various Aggregate Conveyors NSPS Applicability: Subpart OOO II.A.8 Miscellaneous Equipment feeders, conveyors, stackers, wash screws, wash screes, etc. II.A.9 Asphalt Plant Production of Hot Mix Asphalt II.A.10 One (1) Asphalt Mix Drum Drum Rated Capacity: 400 TPH Hot Oil Burner Rating: 165 MMBtu/hr Control: Baghouse NSPS Applicability: Subpart I II.A.11 One (1) Scalping Screen Size: 6' x 20' Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.12 One (1) Hot Oil Heater Rating: < 0.25 MMBtu/hr Control: Low NOx Burner II.A.13 One (1) Waste Oil Storage Tank Maximum Capacity: 15,000 gallons II.A.14 Three (3) Asphalt Oil Storage Tanks Maximum Capacity: 30,000 gallons Each NSPS Applicability: Subpart I II.A.15 One (1) Lime Silo Maximum Capacity: 40 Tons Control: Baghouse NSPS Applicability: Subpart I II.A.16 Three (3) Asphalt Storage Silos Maximum Capacity: 300 Tons Each Control: Baghouse NSPS Applicability: Subpart I II.A.17 One (1) Fly Ash Silo (New) Maximum Capacity: 40 Tons Control: Baghouse NSPS Applicability: Subpart I II.A.18 Five (5) Diesel Storage Tanks Maximum Capacity: 6,000 Gallons Total DAQE-AN158520002-24 Page 7 SECTION II: SPECIAL PROVISIONS II.B REQUIREMENTS AND LIMITATIONS II.B.1 Site Wide Requirements II.B.1.a Unless otherwise specified in this AO, the owner/operator shall not allow visible emissions from any source on site to exceed 20% opacity. [R307-201-3, R307-401-8] II.B.1.b Unless otherwise specified in this AO, opacity observations of visible emissions from stationary sources shall be conducted according to 40 CFR 60, Appendix A, Method 9. [R307-201-3] II.B.2 Aggregate Pit Requirements II.B.2.a The owner/operator shall not produce more than 800,000 tons of processed aggregate material per rolling 12-month period. [R307-401-8] II.B.2.a.1 The owner/operator shall: A. Determine production by scale house records or vendor receipts. B. Record production on a daily basis C. Use the production data to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months D. Keep the production records for all periods the plant is in operation. [R307-401-8] II.B.2.b Visible emissions from the following emission points shall not exceed the following values: A. Crushers - 12% opacity B. Screens - 7% opacity C. All Conveyor Transfer Points - 7% opacity. [R307-312, R307-401-8] II.B.2.c The owner/operator shall install water sprays on all crushers, all screens, all conveyor transfer points, and all conveyor drop points to control emissions. Sprays shall operate as required to ensure the opacity limits in this AO are not exceeded. [R307-401-8] II.B.2.d The owner/operator shall perform monthly periodic inspections to check that water is flowing to discharge spray nozzles associated with each crusher, screen, and conveyor. If the owner/operator finds that water is not flowing properly during an inspection of the water spray nozzles, the owner/operator shall initiate corrective action within 24 hours and complete corrective action as expediently as practical. [40 CFR 60 Subpart OOO, R307-401-8] DAQE-AN158520002-24 Page 8 II.B.2.d.1 Records of the water sprays inspections shall be kept and maintained in a logbook for all periods when the plant is in operation. The records shall include the following items: A. Date the inspections were made B. Any corrective actions taken C. Control mechanism used if sprays are not operating. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.e The owner/operator shall conduct an initial performance test for all crushers, screens, and conveyor transfer points on site within 60 days after achieving maximum production rate but not later than 180 days after initial startup. Performance tests shall meet the limitations specified in Table 3 of Subpart OOO. Records of initial performance tests shall be kept and maintained on site for the lifetime of the equipment. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.e.1 Initial performance tests for fugitive emission limits shall be conducted according to 40 CFR 60.675(c). The owner/operator may use methods and procedures specified in 40 CFR 60.675(e) an alternative. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.e.2 The owner/operator shall submit written reports of the results of all performance tests conducted to demonstrate compliance with 40 CFR 60.672 to the Director, attn.: Compliance Section. The submission shall be postmarked no later than 180 days from the date of this AO or no later than 180 days from equipment start-up, whichever is later. [40 CFR 60 Subpart OOO, R307-401-8] II.B.3 All Haul Roads and Fugitive Dust Sources Requirements II.B.3.a The owner/ operator shall not exceed the following: A. 18.00 acres of storage pile and disturbed ground combined B. 9,980 feet (1.89 miles) of unpaved haul roads. [R307-401-8] II.B.3.a.1 Compliance shall be determined through GPS measurements or aerial photographs. Reclaimed areas such as those with emerged vegetation or hydro-seeded do not contribute to the acreage totals. [R307-401-8] II.B.3.b The owner/operator shall ensure the entry haul road is paved for no less than 3,000 feet (0.57 miles) in length. [R307-401-8] II.B.3.b.1 The paved road length shall be determined through source records or GPS measurements. [R307-401-8] II.B.3.c The owner/operator shall not allow visible emissions to exceed the following: A. Haul roads - 20% opacity B. Storage Piles - 10% opacity C. All other fugitive dust sources - 20% opacity D. All sources at the property boundary -10% opacity. [R307-309-5] DAQE-AN158520002-24 Page 9 II.B.3.d Visible emission determinations for fugitive dust from haul roads and operational areas shall use procedures similar to Method 9. The normal requirement for observations to be made at 15-second intervals over a six-minute period, however, shall not apply. Visible emissions shall be measured at the densest point of the plume but at a point not less than one-half vehicle length behind the vehicle and not less than one-half the height of the vehicle. [R307-309-5] II.B.3.e The owner/operator shall comply with a fugitive dust control plan (FDCP) consistent with R307-309-6. [R307-309-6, R307-401-8] II.B.3.f The owner/operator shall comply with all applicable requirements of R307-309 for Fugitive Emission and Fugitive Dust sources on site. [R307-309, R307-401-8] II.B.3.g An operational sweeper and water truck shall be made available during each operating day. The owner/operator shall vacuum sweep and flush with water all the paved haul roads on site to maintain opacity limits listed in this AO. If the temperature is below freezing, the owner/operator shall continue to vacuum sweep the road but may stop flushing the paved haul roads with water. Flushing the paved haul road with water shall resume when the temperature is above freezing. If the haul roads are covered with snow or ice, the owner/operator may stop vacuum sweeping the paved haul roads. Vacuum sweeping the paved haul roads shall resume when the haul roads are cleared from snow and ice. [R307-401-8] II.B.3.g.1 Records of vacuum sweeping and water application shall be kept for all periods when the plant is in operation. The records shall include the following items: A. Date and time treatments were made B. Number of treatments made and quantity of water applied C. Rainfall amount received, if any D. Records of temperature, if the temperature is below freezing E. Records shall note if the paved haul roads are covered with snow or ice. [R307-401-8] II.B.3.h The owner/operator shall cover all unpaved haul roads and wheeled-vehicle operational areas with road base material, and an operational water truck shall be made available during each operating day. The owner/operator shall use chemical suppressant and water application to maintain opacity limits listed in this AO. If the temperature is below freezing, the owner/operator may stop applying chemical suppressant and water to the unpaved haul roads and wheeled-vehicle operational areas. The owner/operator shall resume applying chemical suppressant and water to the unpaved haul roads and wheeled-vehicle operational areas when the temperature is above freezing. [R307-401-8] DAQE-AN158520002-24 Page 10 II.B.3.h.1 Records of chemical suppressant and water application shall be kept for all periods when the plant is in operation. The records shall include the following items: A. Date and time treatments were made B. Number of treatments made, quantity of water applied, and chemical dilution ratio used C. Rainfall amount received, if any D. Records of temperature, if the temperature is below freezing. [R307-401-8] II.B.3.i The owner/operator shall control particulate emissions from storage piles using water trucks and/or water cannons. The water trucks and/or water cannons shall operate as required to ensure the opacity limits in this AO are not exceeded. [R307-401-8] II.B.3.i.1 Records of water application to the storage piles kept for all periods when the plant is in operation. The records shall include the following items: A. The date, time, and location of applications B. The volume of water applied. [R307-401-8] II.B.3.j The owner/operator shall not exceed 1,800 bulldozing hours per rolling 12-month period. [R307-401-8] II.B.3.j.1 The owner/operator shall: A. Determine hours of operation with a supervisor monitoring and maintaining an operations log. The hours of operation of each bulldozer shall be added together to determine the total hours B. Record hours of operation each day C. Use the hours of operation to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months D. Keep hours of operation records for all periods the plant is in operation. [R307-401-8] II.B.3.k The owner/operator shall not conduct blasting operations before 10:00 am or after 2:00 pm each day. [R307-401-8] II.B.3.k.1 The owner/operator shall keep and maintain the following records of operation for all periods of blasting: A. Time blasting operations begin each day B. Time blasting operations end each day. [R307-401-8] DAQE-AN158520002-24 Page 11 II.B.3.l The owner/operator shall not exceed the following blasting limits: A. 30 blasts per rolling 12-month period B. 126 tons of ANFO used per rolling 12-month period C. An area of 6,262 square feet blasted per blast. [R307-401-8] II.B.3.l.1 Records of blasts shall be kept for all periods when the plant is in operation. The records shall include the following: A. Date of each blast B. Area of each blast C. Tons of ANFO used for each blast. The owner/operators shall use the records to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months. [R307-401-8] II.B.3.m The owner/operator shall not conduct drilling operations before 7:00 am or after 5:00 pm each day. [R307-401-8] II.B.3.m.1 The owner/operator shall keep and maintain the following records of operation for all periods of drilling: A. Time drilling operations begin each day B. Time drilling operations end each day. [R307-401-8] II.B.3.m.2 The owner/operator shall control emissions from drilling operations with the use of drill mounted water sprays (water injection) and drill shrouds. [R307-401-8] II.B.4 Hot Mix Asphalt Plant Operating Requirements II.B.4.a The owner/operator shall not produce more than 250,000 tons of hot mix asphalt per rolling 12-month period. [R307-401-8] II.B.4.a.1 The owner/operator shall: A. Determine production by the belt scale on the initial feeder, vendor receipts, or other methods approved by the Director B. Record production on a daily basis C. Use the production data to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months D. Keep the production records for all periods the plant is in operation. [R307-401-8] DAQE-AN158520002-24 Page 12 II.B.4.b The owner/operator shall not operate the hot mix asphalt plant during the months of January and February. [R307-401-8] II.B.4.b.1 Records of operation shall be kept for all periods when the plant is in operation. Supervisor monitoring and maintaining of an operations log shall determine days of operation. [R307-312, R307-401-8] II.B.4.c The owner/operator shall use natural gas, propane, fuel oil, or on-specification used oil as defined in R315-15, or any combination thereof as fuel in the hot mix asphalt plant. [R307-401-8] II.B.4.d The sulfur content of any fuel oil burned in the hot mix asphalt plant shall not exceed 15 ppm by weight. [R307-401-8] II.B.4.d.1 The sulfur content shall be determined by ASTM Method D2880-71, D4294-89, or approved equivalent. Certification of fuel oil shall be either by the owner/operator's own testing or by test reports from the fuel oil marketer. [R307-203-1, R307-401-8] II.B.4.d.2 The owner/operator shall keep and maintain records of the test certification of sulfur content in fuel oil. Records of the test certifications shall be kept for all periods when the plant is in operation. [R307-203-1, R307-401-8] II.B.4.e The owner/operator shall comply with the limitations and compliance requirements under R307-312-5 for burning a fuel other than natural gas or liquefied petroleum gas (LPG). [R307-312] II.B.4.f The owner/operator shall maintain fuel records for the months of November and December. [R307-401-8] II.B.5 Baghouse Requirements II.B.5.a The owner/operator shall equip each lime, fly ash, and asphalt storage silo with a baghouse to control particulate emissions generated during filling and emptying of the silos. Each baghouse shall be used during all periods of loading and unloading. [R307-401-8] II.B.5.b The owner/operator shall not allow visible emissions from any baghouse to exceed 10% opacity. [R307-401-8] II.B.5.c The owner/operator shall install a manometer or magnehelic pressure gauge to measure the differential pressure across each baghouse. [R307-401-8] II.B.5.c.1 Each pressure gauge shall be located such that an inspector/operator can safely read the indicator at any time. [R307-401-8] II.B.5.c.2 Each pressure gauge shall measure the pressure drop in 1-inch water column increments or less. [R307-401-8] II.B.5.d During operation of the asphalt drum mixer baghouse, the owner/operator shall maintain the static pressure drop across the baghouse between 2.0 and 6.0 inches of water column. During operation of the storage silo baghouses, the owner/operator shall maintain the static pressure drop within the range recommended by the manufacturer for normal operations. [R307-401-8] II.B.5.d.1 The owner/operator shall record the pressure drop at least once per operating day while each baghouse is operating. [R307-401-8] DAQE-AN158520002-24 Page 13 II.B.5.d.2 The owner/operator shall maintain the following records of the pressure drop readings: A. Unit identification; B. Manufacturer recommended static pressure drop for the unit (if applicable); C. Date of reading; D. Daily static pressure drop readings. [R307-401-8] II.B.5.e At least once every 12 months, the owner/operator shall calibrate the pressure gauges in accordance with the manufacturer's instructions or replace the gauges. [R307-401-8] II.B.5.e.1 The owner/operator shall maintain records of the pressure gauge calibrations and replacements. [R307-401-8] II.B.5.f The owner/operator shall install a baghouse on each lime, fly ash, and asphalt storage silo with a control efficiency of no less than 98%. [R307-401-8] II.B.5.f.1 To demonstrate compliance with the above condition, the owner/operator shall maintain records of the manufacturer's control efficiency guarantee for the installed baghouse. [R307-401-8] II.B.5.g The owner/operator shall use a baghouse to control process streams from the asphalt plant drum. The baghouse shall be sized to handle at least 69,000 ACFM. All exhaust air from the drum shall be routed through the baghouse before being vented to the atmosphere. [R307-401-8] II.B.5.h The owner/operator shall not emit more than the following rates and concentrations from the Asphalt Plant Baghouse: Pollutant grains/dscf Filterable PM10 0.024 Filterable PM2.5 0.024 [R307-801-8] II.B.5.h.1 Compliance Demonstration To demonstrate compliance with the emission limitations above, the owner/operator shall perform stack testing on the emissions unit according to the stack testing conditions contained in this AO. The owner/operator shall test for condensable PM; however, the condensable particulate emissions shall not be used for compliance demonstration, but shall be used for inventory purposes. [R307-165-2, R307-401-8] II.B.5.h.2 Initial Test The owner/operator shall conduct an initial stack test on the emission unit within 180 days after startup of the emission unit. [R307-165-2] II.B.5.h.3 Test Frequency The owner/operator shall conduct a stack test on the emission unit within three (3) years after the date of the most recent stack test of the emission unit. The Director may require the owner/operator to perform a stack test at any time. [R307-165-2, R307-401-8] DAQE-AN158520002-24 Page 14 II.B.6 Stack Testing Requirements II.B.6.a The owner/operator shall conduct any stack testing required by this AO according to the following conditions. [R307-401-8] II.B.6.a.1 Notification At least 30 days prior to conducting a stack test, the owner/operator shall submit a source test protocol to the Director. The source test protocol shall include the items contained in R307-165-3. If directed by the Director, the owner/operator shall attend a pretest conference. [R307-165-3, R307-401-8] II.B.6.a.2 Testing & Test Conditions The owner/operator shall conduct testing according to the approved source test protocol and according to the test conditions contained in R307-165-4. [R307-165-4, R307-401-8] II.B.6.a.3 Access The owner/operator shall provide Occupational Safety and Health Administration (OSHA)- or Mine Safety and Health Administration (MSHA)-approved access to the test location. [R307-401-8] II.B.6.a.4 Reporting No later than 60 days after completing a stack test, the owner/operator shall submit a written report of the results from the stack testing to the Director. The report shall include validated results and supporting information. [R307-165-5, R307-401-8] II.B.6.a.5 Possible Rejection of Test Results The Director may reject stack testing results if the test did not follow the approved source test protocol or for a reason specified in R307-165-6. [R307-165-6, R307-401-8] II.B.6.b Test Methods When performing stack testing, the owner/operator shall use the appropriate EPA-approved test methods as acceptable to the Director. Acceptable test methods for pollutants are listed below. [R307-401-8] II.B.6.b.1 Standard Conditions A. Temperature - 68 degrees Fahrenheit (293 K) B. Pressure - 29.92 in Hg (101.3 kPa) C. Averaging Time - As specified in the applicable test method. [40 CFR 60 Subpart A, 40 CFR 63 Subpart A, R307-401-8] II.B.6.b.2 Filterable PM10 40 CFR 60, Appendix A, Method 5; 40 CFR 51, Appendix M, Method 201; Method 201A; or other EPA-approved testing method as acceptable to the Director. If other approved testing methods are used which cannot measure the PM10 fraction of the filterable particulate emissions, all of the filterable particulate emissions shall be considered PM10. [R307-401-8] II.B.6.b.3 Filterable PM2.5 40 CFR 60, Appendix A, Method 5; 40 CFR 51, Appendix M, Method 201A or other EPA-approved testing method as acceptable to the Director. If other approved testing methods are used which cannot measure the PM2.5 fraction of the filterable particulate emissions, all of the filterable particulate emissions shall be considered PM2.5. [R307-401-8] DAQE-AN158520002-24 Page 15 II.B.6.b.4 Condensable PM 40 CFR 51, Appendix M, Method 202 or other EPA-approved testing method as acceptable to the Director. [R307-401-8] PERMIT HISTORY This Approval Order shall supersede (if a modification) or will be based on the following documents: Supersedes AO DAQE-AN158520001-18 dated November 29, 2018 Is Derived From NOI dated February 2, 2022 Incorporates Additional Information Received dated March 11, 2022 Incorporates Additional Information Received dated April 4, 2022 Incorporates Additional Information Received dated September 1, 2022 Incorporates DAQE-MN158520002-22 dated September 9, 2022 DAQE-AN158520002-24 Page 16 ACRONYMS The following lists commonly used acronyms and associated translations as they apply to this document: 40 CFR Title 40 of the Code of Federal Regulations AO Approval Order BACT Best Available Control Technology CAA Clean Air Act CAAA Clean Air Act Amendments CDS Classification Data System (used by Environmental Protection Agency to classify sources by size/type) CEM Continuous emissions monitor CEMS Continuous emissions monitoring system CFR Code of Federal Regulations CMS Continuous monitoring system CO Carbon monoxide CO2 Carbon Dioxide CO2e Carbon Dioxide Equivalent - Title 40 of the Code of Federal Regulations Part 98, Subpart A, Table A-1 COM Continuous opacity monitor DAQ/UDAQ Division of Air Quality DAQE This is a document tracking code for internal Division of Air Quality use EPA Environmental Protection Agency FDCP Fugitive dust control plan GHG Greenhouse Gas(es) - Title 40 of the Code of Federal Regulations 52.21 (b)(49)(i) GWP Global Warming Potential - Title 40 of the Code of Federal Regulations Part 86.1818- 12(a) HAP or HAPs Hazardous air pollutant(s) ITA Intent to Approve LB/YR Pounds per year MACT Maximum Achievable Control Technology MMBTU Million British Thermal Units NAA Nonattainment Area NAAQS National Ambient Air Quality Standards NESHAP National Emission Standards for Hazardous Air Pollutants NOI Notice of Intent NOx Oxides of nitrogen NSPS New Source Performance Standard NSR New Source Review PM10 Particulate matter less than 10 microns in size PM2.5 Particulate matter less than 2.5 microns in size PSD Prevention of Significant Deterioration PTE Potential to Emit R307 Rules Series 307 R307-401 Rules Series 307 - Section 401 SO2 Sulfur dioxide Title IV Title IV of the Clean Air Act Title V Title V of the Clean Air Act TPY Tons per year UAC Utah Administrative Code VOC Volatile organic compounds 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 536-4414 www.deq.utah.gov Printed on 100% recycled paper DAQE-MN158520002B-24 M E M O R A N D U M TO: 15852: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant (N158520002) THROUGH: Alan Humpherys, Minor NSR Manager – Air Quality FROM: Christine Bodell, Environmental Engineer – Air Quality DATE: February 13, 2024 SUBJECT: Response to Comments for DAQE-IN158520002-22 Kilgore Contracting, LLC (Kilgore) operates the Benjamin Pit asphalt and aggregate processing plant in Utah County. Kilgore has requested a modification to its Approval Order (DAQE- AN158520001-18). The modification includes a request to increase aggregate production from 600,000 tons per year (tpy) to 800,000 tpy, to increase hot mix asphalt production from 210,000 tpy to 250,000 tpy, to increase the combined storage pile area and disturbed area by 6 acres for a total of 18 acres, and to add one 40-ton fly ash silo. The completed engineering evaluation and air quality impact analysis showed the proposed project meets the requirements of the federal and state air quality regulations. The Director published the Intent to Approve (ITA) DAQE-IN158520002-22 for this project on November 30, 2022, which started a 30-day public comment period. Within 15 days of the start of the public comment period, an extension to the public comment period and a public hearing were requested. Comments received at the public hearing and written comments received via email by the Division of Air Quality (Division or DAQ) on or before January 29, 2023, (the last day of the extended public comment period) are included in this memorandum along with the Division’s responses. The comments are pasted in their original form with spelling and punctuation preserved. State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director CB 2 Comments received by the Division after the public comment period ended are not addressed in this memorandum. Permitting Questions Comment P1 - Received on December 27, 2022 Would you please define disturbed land and stockpiles? Does it not actually mean disturbed land and stockpiles? How is the plant footprint determined? Are haul roads not paved with R AP counted? Kilgore has also disturbed 3.31 acres on phase B. Per Kilgore’s mining plan with the DOGM Phase B which is not to be mined until reclamation grading has begun on phase A. Have they begun grading it? It is not visible on google earth map? There are still benches and a face to mine out on it. I have been told there are 2 years of mining left on the face. They also have disturbed a huge area for what may be the detention pond for phase B. Is that going to be a dust bowl for 2 years? No wonder there has been more fugitive dust this year I am concerned we do not have an accurate accounting of the hazardous chemicals created when Kilgore burns used oil. My understanding is that this is where most of the HAPS would be created. 3 Kilgore claims that their mine is electrically operated. However, they stock huge amounts of burning oil and I have been told it is delivered weekly. I think you said there are 3 ways to monitor the pollution created. Can you please provide that information again and explain why having Kilgore submit receipts was not selected as the best method to determine the pollution actually released into our air? Is this something that can be changed? DAQ Response to Comment P1: The commenter requested that the DAQ define disturbed land and stockpiles. The U.S. Environmental Protection Agency (EPA) published a compilation of air pollutant emissions factors known as AP-42. The EPA recommends that AP-42 be used as a primary reference for estimating emissions from sources of air pollution. “The emissions factors have been developed and compiled from source test data, material balance studies, and engineering estimates.”1 The DAQ frequently references AP-42 in emission estimate calculations. Disturbed areas are described in AP-42, Chapter 11.9 as areas without vegetation that are subject to wind erosion.2 Chapter 13.2.5 further defines disturbance “as an action that results in the exposure of fresh surface material.”3 This area does not include haul roads or areas in which “fresh surface material” is not exposed. Disturbed areas, therefore, would not include the HMA plant working area, haul roads, areas where equipment is stationary, or paved areas. AP-42 Chapter 13.2.4 defines storage piles as “inherent in operations that use minerals in aggregate form” that are “usually left uncovered, partially because of the need for frequent material transfers into or out of storage.”4 AP-42 Chapter 13.2.4 also states, Total dust emissions from aggregate storage piles result from several distinct source activities within the storage cycle: 1. Loading of aggregate onto storage piles (batch or continuous drop operations). 2. Equipment traffic in the storage area. 3. Wind erosion of pile surfaces and ground areas around piles. 4. Loadout of aggregate for shipment or for return to the process stream (batch or continuous drop operations).5 The commenter has also asked how the plant footprint is determined. The determination of the plant footprint is outlined in Condition II.B.3.a.1 of the proposed Approval Order, which states that “compliance shall be determined through GPS measurements or aerial photographs. Reclaimed areas such as those with emerged vegetation or hydro-seeded do not contribute to the acreage totals.” The commenter has included issues in the comment that DAQ does not have the authority to regulate. Specifically, the mining phases and reclamation activities that the Division of Oil Gas and Mining (DOGM) or Bureau of Land Management (BLM) regulate. It is recommended that these agencies be contacted with these questions. 1 AP-42: Compilation of Air Emissions Factors | US EPA, available at https://www.epa.gov/air -emissions-factors- and-quantification/ap-42-compilation-air-emissions-factors. 2 See AP-42, Chapter 11.9 at 11.9-1, available at https://www3.epa.gov/ttnchie1/ap42/ch11/final/c11s09.pdf. 3 Id., Chapter 13.2.5 at 13.2.5-2, available at https://www3.epa.gov/ttnchie1/ap42/ch13/final/c13s0205.pdf. 4 Id., Chapter 13.2.4 at 13.2.4-1, available at https://www.epa.gov/sites/default/files/2020- 10/documents/13.2.4_aggregate_handling_and_storage_piles.pdf. 5 Id., at 13.2.4-3. 4 The commenter has expressed concern that Kilgore stocks burning oil, despite Kilgore’s claims that the mine is electrically operated. Per the Notice of Intent (NOI) application, the pit utilizes line power for its crushers, screens, conveyors, and the mechanical operation of the hot-mix asphalt drum. However, the heat source in the hot-mix asphalt drum is from the combustion of recycled fuel oil (RFO). Kilgore’s request to increase hot-mix asphalt production will result in an increase of 0.20 tons per year of hazardous air pollutants (HAPs). The commenter has asked DAQ to explain why the submission of fuel receipts was not selected as the best method to determine air pollutants released into the atmosphere from the operation. There are different approaches to limiting HAPs emissions, including the implementation of production, operation, or throughput limits. In this case, HAPs emission calculations for the oil combustion in the hot-mix drum are consistent with AP-42 Section 11.1, Table 11.1-10,6 which specifies that emission factor units are pound per ton (lb/ton) of hot mix asphalt produced. This is why DAQ imposed a limit on the production of hot mix asphalt in Condition II.B.4.a. (The owner/operator shall not produce more than 250,000 tons of hot mix asphalt per rolling 12-month period). This limit is designed to curb HAPs emissions. Because the DAQ has elected to control HAPs emissions by limiting asphalt production, having Kilgore submit fuel receipts is not needed. The requirement for Kilgore to keep records of asphalt production is outlined in Condition II.B.5.a.1. 6 Id., Section 11.1 (Hot Mix Asphalt Plants), Table 11.1-10 at 11.1-21 through 11.1-27 available at https://www3.epa.gov/ttnchie1/ap42/ch11/final/c11s01.pdf. 5 Comment P2 - Received on January 10, 2023 Please provide the documents that the DAQ decision that Spray Bars and Spraying by truck are equal. Also please advise if the change will release Kilgore of their requirement to use spray bars on production piles. DAQ Response to Comment P2: To evaluate control efficiency for storage piles, the DAQ used AP-42 Appendix B.2 (Generalized Particle Size Distributions) document.7 Water cannons and water trucks use the same mechanism — “water sprays”— to control emissions. Table B.2-3 (Typical Collection Efficiencies of Various Particulate Control Devices), Row 061 of the AP-42 Appendix B.28 indicates that water sprays can provide a 40-90% control efficiency depending on the particle size. Based on this document, water cannon spray and water truck spray were found to be equally efficient for water-based controls. The requirement to apply water sprays is included in Condition II.B.3.i of the draft Approval Order (“The owner/operator shall control particulate emissions from storage piles using water trucks and/or water cannons. The water trucks and/or water cannons shall operate as required to ensure the opacity limits in this approval order are not exceeded.”). The commenter asked if “the change will release Kilgore of their requirement to use spray bars on production piles.” This condition will allow Kilgore to comply with the Approval Order without the use of spray bars, provided that the company uses water trucks according to the terms of the Approval Order. 7 The document can be found at https://www.epa.gov/sites/default/files/2020-11/documents/appb-2.pdf. 8 At B.2-20 through B.2-21. 6 The DAQ reached out to Kilgore to further investigate the ability of the water trucks to reach the tops of the storage piles. Kilgore indicated that it is confident in the water suppression equipment to manage and apply complete coverage of water suppressant to single-layer stockpiles. The high- pressure nozzles on the company water trucks allow the water to reach up to 17 feet. Should stockpiles be double stacked, incline haul access would allow company water trucks to reach higher elevations and apply coverage to the tops of stockpiles. This control will be verified by the opacity limits listed in the Approval Order. Comment P3 - Received on January 10, 2023 I am struggling to understand how there is a negative result when the acreage has increased by 6 acres. From all the dust we see coming off Kilgore it is difficult to believe that they are achieving the high control rates shown. What factors contribute to the high control rate? Is there a percentage of moisture required in the storage piles to achieve the 90% control specified? DAQ Response to Comment P3: The decrease in pollutants from this project occurs for greenhouse gasses (CO2e) and NOx. The increase in 6 acres of storage piles and disturbed area will increase emissions of PM10 and PM2.5. The control rate for PM10 and PM2.5 is based on data presented in the AP-42 Appendix B.2 (Generalized Particle Size Distributions) document.9 As stated in this document, “Efficiencies are representative of well-designed and well-operated control equipment. Site-specific factors (e.g., type of particulate being collected, varying pressure drops across scrubbers, maintenance of equipment, etc.) will affect collection efficiencies. Efficiencies shown are intended to provide guidance for estimating control equipment performance when source-specific data are not available.”10 According to AP-42 Chapter 13.2.4 (Aggregate Handling and Storage Piles), “emissions also depend on 3 parameters of the condition of a particular storage pile: age of the pile, moisture content, and proportion of aggregate fines.”11 For emissions from storage piles, a percentage of moisture required to achieve 90% control is not specified in the AP-42 Appendix B.2 (Generalized Particle Size Distributions) document. 9 Available at https://www.epa.gov/sites/default/files/2020-11/documents/appb-2.pdf. 10 AP-42 Appendix B.2 at B.2-21, footnote a. 11 https://www.epa.gov/sites/default/files/2020-10/documents/13.2.4_aggregate_handling_and_storage_piles.pdf 7 Comment P4 - Received on January 10, 2023 Is this information from an approved source? DAQ Response to Comment P4: The paper can be found at the following URL: https://www.sciencedirect.com/science/article/abs/pii/S1352231008006390. It is published and peer reviewed. Peer-reviewed, scientific journals are sources that can be considered when estimating emissions. The permitting engineer has the option to evaluate these assumptions. If the emission factors are in question, the engineer may require additional testing, monitoring, record keeping, or reporting to ensure the assumptions in the permit application are reflective of actual operations on site. According to the United States Geological Survey, the peer-review process subjects an author’s scholarly work, research, or ideas to the scrutiny of others who are experts in the same field (peers) and is considered necessary to ensure academic scientific quality.12 Due to the quality-control nature of the peer-review process, the paper referenced in the comment is considered an approved source of information. 12 https://www.usgs.gov/faqs/what-does-it-mean-when-a-publication-peer- reviewed#:~:text=A%20peer%2Dreviewed%20publication%20is,to%20ensure%20academic%20scientific%20quali ty. 8 Comment P5 - Received on January 10, 2023 Why is there a negative on the Co@ equivalent of -2199.53 and Nitrogen Oxides of -1.97 DAQ Response to Comment P5:13 A negative value in the “Change (TPY)” column means that the requested changes and updated calculations will result in a reduction of potential to emit for that particular pollutant. The entire site-wide potential to emit was recalculated by Kilgore using the most up-to-date emission factors and guidance. Kilgore’s calculations were verified and accepted by the DAQ. 13 DAQ has inferred that the above comment is related to “CO2 Equivalent” or “CO2e” instead of “Co@.” 9 Comment P6 - Received on January 10, 2023 Can you please provide info on this conveyor. How long is it? What is the capacity? How is fugitive dust controlled? Is it electrical or fuel engine driven? What are the hours of operation? DAQ Response to Comment P6: The length of the conveyor is not factored into DAQ calculations, as emission estimates are based on the hourly and annual throughputs (transfer) of material. The conveyor capacities are limited to the capacities of the screens and crushers, which each have a maximum capacity of 400 tons per hour of aggregate material. The commenter has asked how the fugitive dust is controlled. Fugitive dust associated with conveyors is controlled by water application. As required by Condition II.B.2.c of the draft 10 Approval Order, “The owner/operator shall install water sprays on all crushers, all screens, all conveyor transfer points, and all conveyor drop points to control emissions. Sprays shall operate as required to ensure the opacity limits in this AO are not exceeded.” The commenter has also asked if the conveyors are electrical or fuel engine driven and the hours of operation of the conveyors. The conveyors are electrical. Because emissions are based on throughput and not hours of operation, the aggregate plant is permitted to operate up to 24 hours each day. Essentially, the plant’s throughput will limit the hours of its operation. The NOI and modeling report included this conveyor, but Kilgore had forgotten to add it to its equipment list in the initial NOI. This error was reviewed and discussed with Kilgore to ensure the most recent modeling analysis and emission calculations were accurate. Comment P7 - Received on January 10, 2023 Where are these control rates from. How wet how often is spraying required. how often is a chemical suppressant used on roads so often disturbed? DAQ Response to Comment P7: Haul Road PM10 and PM2.5 emissions were calculated using emission factors from AP-42 Section 13.2 for Unpaved and Paved Roads.14 A control percentage of 85% was assumed for chemical suppression and watering on unpaved roads. A control percentage of 95% was assumed for vacuum sweeping, and water application on paved roads. The 14 Available on the EPA webpage at https://www3.epa.gov/ttnchie1/ap42/ch13/. 11 frequency requirements for watering and chemical suppressant are outlined in Conditions II.B.3.g and II.B.3.h of the draft Approval Order. These conditions are listed below. Condition II.B.3.g: “An operational sweeper and water truck shall be made available during each operating day. The owner/operator shall vacuum sweep and flush with water all the paved haul roads on site to maintain opacity limits listed in this AO. If the temperature is below freezing, the owner/operator shall continue to vacuum sweep the road but may stop flushing the paved haul roads with water. Flushing the paved haul road with water shall resume when the temperature is above freezing. If the haul roads are covered with snow or ice, the owner/operator may stop vacuum sweeping the paved haul roads. Vacuum sweeping the paved haul roads shall resume when the haul roads are cleared from snow and ice.” Condition II.B.3.h: “The owner/operator shall cover all unpaved haul roads and wheeled-vehicle operational areas with road base material, and an operational water truck shall be made available during each operating day. The owner/operator shall use chemical suppressant and water application to maintain opacity limits listed in this AO. If the temperature is below freezing, the owner/operator may stop applying chemical suppressant and water to the unpaved haul roads and wheeled-vehicle operational areas. The owner/operator shall resume applying chemical suppressant and water to the unpaved haul roads and wheeled-vehicle operational areas when the temperature is above freezing.” Therefore, water and chemical suppressant are applied as needed to ensure the opacity limits listed in the Approval Order are not exceeded. 12 Comment P8 - Received on January 13, 2023 I have looked and have not been able to locate the information that Kilgore provided to determine the storage pile estimated pollution as per below; DAQ Response to Comment P8: Kilgore’s calculations for storage piles and disturbed area emissions can be found in Table C-13 on page 68 of Kilgore’s NOI in Appendix B - Emission Calculations. Comment P9 - Received on January 15, 2023 Please explain why haul roads are modeled by production and how is the number determined? DAQ Response to Comment P9: Unless there are specific conditions in the permit that limit the use of the haul roads, haul roads are modeled at the maximum hourly emission rate for the entire period the facility is allowed to operate. Emissions from haul roads are estimated using AP-42 Section 13.2.2 where emission factors are expressed in pounds (lb) of size-specific particulate emissions per vehicle mile traveled (VMT).15 15 AP-42, Chapter 13.2.2 at 13.2.2-4, available at https://www.epa.gov/sites/default/files/2020- 10/documents/13.2.2_unpaved_roads.pdf. 13 The VMT depends on the maximum vehicle weight, the length of a haul road, and hourly and annual production levels. To obtain the uncontrolled emission factors, equation 1a in AP-42 Section 13.2.2 was applied.16 The constants for equation 1a based on the stated aerodynamic particle sizes are shown in Table 13.2.2-2.17 For unpaved roads, Kilgore is to apply water and chemical suppressants, which reduce particulate emissions by 85%. For paved roads, Kilgore is to apply water and vacuum sweep, which reduce particulate emissions by 95%. Comment P10 - Received on January 16, 2023 What are the amendments? Are the increases included in modeling? 16 See id. 17 See id. at 13.2.2-5. 14 DAQ Response to Comment P10: As indicated in the figure included by the commenter, the amendment was the addition of one (1) conveyor. The modeling includes the emissions from the latest NOI. All emissions from Kilgore were included in the modeling, including any increases. Modeling Questions Comment M1 - Received on January 10, 2023 Can you please tell me where I can read the existing NOI for Kilgore and if the modeling was done in Lindon or in Provo? Thank you DAQ Response to Comment M1: As stated in the ITA, the proposal (NOI) and the evaluation of its impact on air quality is available for the public to review and provide comment during the public comment period. Kilgore’s NOI was posted on the DAQ website during the public comment period in accordance with UAC R407-401-7. The background concentrations for PM10 were based on ambient air data monitored in Lindon because that station is the closest active station to the Kilgore operation. The North Provo monitoring location, not Provo, stopped monitoring in 2017. Collecting the most recent data is more important than proximity to inactive stations because this data includes the latest wildfire smoke. Lindon also has a more complete data record than the North Provo monitoring location. 15 Comment M2 - Received on January 10, 2023 DAQ Response to Comment M2: See DAQ Response to Comment M1. Additionally, the background data used originally by Kilgore was from the North Provo monitoring location. This data was not acceptable as described in DAQ Response to Comment M1 due to it not being recent enough and incomplete. See also DAQ Response to Comment M3 for more details. 16 Comment M3 - Received on January 10, 2023 What were the modeling changes made? DAQ Response to Comment M3: The changes made were that more recent and more complete background PM10 data was used in the analysis. The Lindon site is slightly farther away than the North Provo site from the Kilgore operation, but the data is better for several reasons. The Lindon data is more recent and is the latest data available. Lindon is also the only active PM10 monitor in that area. The latest wind-blown dust and wildfire smoke concentrations are better accounted for in this more recent data. In addition, the data recovery at the Lindon site was 96.5% and the recovery at North Provo was 80.4%, which created a more complete data record. 17 Comment M4 - Received on January 10, 2023 This sounds like Lindon is being used to get lower readings. Please correct me if that is not the case. Concern is Provo may be busier BUT it is much closer to us and our conditions. I am very concerned about this decision. DAQ Response to Comment M4: Please see DAQ Responses to Comments M1 through M3. 18 Comment M5 - Received on January 10, 2023 How does Trinity’s modeling compare to the existing NOI? DAQ Response to Comment M5: The hourly emission rates and operating schedules in the model provided by Trinity were the same as shown in Kilgore’s NOI. 19 Comment M6 - Received on January 11, 2023 Was the modeling totally done or just done on select criteria. I did ask Allen Humphry this question. I was told that the modeling would have needed to be done on the whole process. He did direct me to contact you for the information. Reading through the project scope I would say the whole process was not modeled. If that is the case why wasn’t it. I gathered not running modeling on everything would not be an acceptable option. DAQ Response to Comment M6: Modeling was performed for pollutants that were in attainment in the area they were considered and had the potential to exceed an EPA air quality standard. Air pollution models are most frequently used during the permitting process to verify that a new or modified source of air pollution will not exceed federal health-based standards. These standards, called the National Ambient Air Quality Standards (NAAQS), were established by the EPA to protect human health and the environment. If a pollutant level exceeds the NAAQS, it can harm human health and the environment, and cause property damage. The modeling conducted by the source and by DAQ indicates that the modeled criteria pollutants are below the thresholds set by EPA and are considered safe. 20 Comment M7 - Received on January 11, 2023 Please confirm that modeling was only done on the requested increase. I am concerned. I see areas where it will be necessary to verify the original modeling. For example the disturbed land was 10 acres was the modeling calculated on 10 acres or 12 acres? I hope I am not understanding this correcting and that the modeling was done complete DAQ Response to Comment M7: The emission rates and operating schedules in the model were the same as indicated in the NOI. The total emission rate was modeled. Comment M8 - Received on January 15, 2023 Modeling noted that due to scant traffic only one lane and no overlapping dust was used. This chart shows 7 trucks per hour; 56 trucks a day per an hour , 5 days a week for a year/2000 working hours. If the Benjamin pit is closed any days for winter or any reason the number of trucks per day goes up. Since Kilgores is slow during the winter months the number of trucks increases exponentially. Please provide definition of scant traffic and if this scenario was used on the previous modeling. DAQ Response to Comment M8: There is no official DAQ definition for "scant traffic" for modeling purposes. "Scant traffic" was not mentioned in the DAQ modeling memorandum. The haul roads are modeled as a one lane road since two lane roads are not typical for aggregate pits. This method was also used in the previous model for the Kilgore Benjamin Pit. Modeling emissions from one lane is a more conservative approach than spreading it out over two lanes. The maximum pounds per hour allowed on the road are being modeled for every hour the facility is permitted to operate. Since the maximum rate is conservatively modeled every hour, seasonal or daily closure of the pit will not affect hourly emission estimates used in the model. 21 Comment M9 - Received on January 16, 2023 please confirm I am understand this correctly. Monitoring determined we are only .8 under NAAQS! This is after refining modeling the dust created on haul roads and only considering 1 acre of disturbed land and 18 acres of stock piles! The mining area measures 46.54 acres. DAQ Response to Comment M9: The Clean Air Act requires EPA to set the NAAQS for six common air pollutants (also known as “criteria air pollutants”). If a pollutant level exceeds the NAAQS, it can harm human health and the environment, and cause property damage. The DAQ conducted a 24-hour PM10 modeling analysis. The results indicated that the highest PM10 impact would be 99.2% of NAAQS levels. Therefore, the PM10 emissions are still below the thresholds outlined by EPA and are considered safe. The emission rates and operating schedules in the model were the same as indicated in the NOI. Comment M10 - Received on January 18, 2023 DAQ has already replaced the 2019 permit with the 2022 permit for Kilgore Benjamine pit. I am working on comments and sure could use the previous modeling information to understand changes like this one I inquired on. I assume this reduction is due to change the plume Height from 75 feet to 50. I have seen plumes well over 75 feet. I do not believe this change should have been made. Modeling also changed the hazardous pollutants released by Blasting. Does the DAQ have documented back up showing these are accurate when applied to blasting at the Kilgore Benjamin pit. I do not see any conditions listed in the permit regarding these. Thanks DAQ Response to Comment M10: The source parameters used in the model were the same as the supporting information in the NOI indicated. The lower plume height is expected to cause higher ground level concentrations near the facility property boundary where the maximum impact occurs. Therefore, a lower plume height offers a more conservative emissions estimate. Comment M11 - Received on January 18, 2023 Was the new conveyor belt included in the modeling? DAQ Response to Comment M11: Yes. 22 Compliance Questions Comment C1 - Received on January 12, 2023 Please address why the DAQ accepted a map that did not include all the disturbed land that was observed? I am aware that DAQ compliance is aware of the huge rectangular dust bowl on phase B not included on the map Kilgore submitted. Why wasn’t it addressed? The disturbed land and storage piles are used to calculate TPY of PM fugitive pollution released into the air we breathe in a non attainment area. How can the DAQ make permitting decisions when they don ‘t have the correct information? 23 Please explain why the inspection report shows Kilgore is in compliance with the 12 acres of disturbed land when it is stated on the map they have disturbed 14.84 acres. Kilgore also previously documented they have an additional 14 acres of land not accounted for. If you check the mining progress reports you will see the 14.84 number does not account for all the disturbed land and stock piles. Why are RAP piles being deducted? The erosion and dust coming off of them is toxic. The description of disturbed land does not exclude them. DAQ inspection reports of 20 and 21 show the exact same amount of disturbed land. Please explain how it is that Kilgore held at 11.7 acres for 2 years. It is my understanding that the DAQ is in place to protect the public. To protect it at a level that our health and safety is not at risk. Utah has some of the worst air pollution in the nation. Why is that? Is it just our geography? If that was the case there are many other states that would be right up there with us. I have reviewed air quality regulations in Washington and Maricopa. Could it be that Utah’s air quality plans fall short. Utah does not define the moisture required to control dust when controlled by a spray truck as is done in Maricopa and Washington. Utah simply states as need. Could it be that mining lobbist have made mining to powerful? 24 That the peoples health and safety is not the priority? Inspectors inspected Kilgores’ site for 4 years before realizing they were not using spray bars on the storage piles as required. How does that happen? I have contacted the DAQ with complaints about the dust created by Kilgore exceeding the permit for years. I have requested that the disturbed land and stock piles be verified many times. You have given me the answer that we the people need to get better laws. I am asking the DAQ to fulfill their responsibilities and protect the people. DAQ Response to Comment C1: The commenter has asked why DAQ accepted a map that did not include all the disturbed land that was observed. The NOI application included a site plan of the proposed changes. Under current state law, Kilgore is not required to submit a map that specifies the disturbed land during the permitting process. Additionally, the current Approval Order DAQE-AN158520001-18 condition II.B.3.a.1 and Intent to Approve DAQE-IN158520002- 22 condition II.B.3.a.1 contain requirements on how Kilgore would demonstrate compliance with the acreage limitation on the disturbed ground and storage pile also contained in the Approval Order as follows: “Compliance shall be determined through Global Positioning System (GPS) measurements or aerial photographs. Reclaimed areas such as those with emerged vegetation or hydro-seeded do not contribute to the acreage totals.” Per this condition, Kilgore is not required to submit these records if DAQ Compliance Inspectors can review them on-site at the time of inspection to determine compliance with the total acreage allowed to be disturbed. The commenter has also asked DAQ to “please explain why the inspection report shows Kilgore is in compliance with the 12 acres of disturbed land when it is stated on the map, they have disturbed 14.84 acres.” The DAQ is aware that Kilgore is out of compliance with its current Approval Order. This is being remedied through Kilgore’s current application. The commenter has stated that “Kilgore also previously documented they have an additional 14 acres of land not accounted for.” The DAQ has not received any documentation to support this claim. The commenter has asked why RAP piles are excluded from the disturbed area total. All RAP piles are not counted as stockpiles simply because RAP is not an aggregate nor is it considered an emission source. The inherent nature of RAP piles is that the material binds itself together due to the asphaltic materials within the product and is not considered a wind-driven material or emission source. Kilgore stores RAP at this location on an asphalt pad. RAP is processed occasionally throughout the year, as needed, to create processed storage and is used to subsidize the production of new asphalt in place of newly processed aggregates and asphaltic materials. Once the RAP is transferred from the RAP storage pile and crushed, it is subject to the fugitive dust 25 control requirements outlined in the approval order. The commenter has asked why Utah has poor air quality. Poor air quality is a complex issue that is influenced by population, industry, geography, weather, and other factors. The DAQ recommends the commenter visit the DAQ website, specifically the “Understanding Utah’s Air Quality” page at https://deq.utah.gov/air-quality/understanding-utahs-air-quality. The web page provides an overview of the prevalent pollutants, explains what Utah is doing to reduce air pollution, and provides examples of how residents can help mitigate air pollution. The commenter has asked why the DAQ inspectors took four years to discover that Kilgore was not using spray bars on storage piles. DAQ assumes that the commenter is referring to Condition II.B.3.h of the current approval order, which reads “The owner/operator shall install and maintain water sprays on all storage piles to control emissions. Sprays shall operate as required to ensure the opacity limits in this AO are not exceeded.” Per a full compliance evaluation conducted on August 22, 2022, Kilgore had not installed water sprays on all storage piles, as required by the current approval order. However, Kilgore had been using side cannons on the water trucks to regularly water the storage piles. Kilgore suggested that the water cannons installed on the water trucks sufficiently met the criteria that all storage piles have water sprays installed. Per EPA AP-42 Appendix B.2, water cannons and water trucks use the same mechanism—”water sprays”—to control emissions. Table B.2-3 (Typical Collection Efficiencies of Various Particulate Control Devices), Row 061 of the AP-42 Appendix B.2 indicates that water sprays can provide a 40-90% control efficiency depending on the particle size.18 Based on EPA’s data, water cannon spray and water truck spray were found to be equally as efficient for water-based controls. Therefore, the DAQ accepted that the water truck cannons were providing sufficient fugitive dust control for the storage piles. However, per the current Approval Order and as pointed out by the commenter, Kilgore was out of compliance with this condition. This is being remedied through Kilgore’s current application. The proposed Approval Order will replace the current condition with the following condition: “The owner/operator shall control particulate emissions from storage piles using water trucks and/or water cannons. The water trucks and/or water cannons shall operate as required to ensure the opacity limits in this AO are not exceeded.” This will give Kilgore flexibility for water application techniques while still providing sufficient control for fugitive dust emissions from storage piles. It is important to note that even though the method of controlling emissions as specified in the Approval Order was not exactly followed by Kilgore, the method the company used kept it in compliance with the opacity limits. 18 Appendix B.2. Generalized Particle Size Distributions -- September 1996, available at https://www.epa.gov/air- emissions-factors-and-quantification/ap-42-compilation-air-emissions-factors 26 General Comment G1 - Received on January 16, 2023 We feel the Earth move under our feet. (MY dishes shake in the kitchen like an earthquake) We smell the air tumbling down. (and see it too)(Asphalt) PU Headaches and health troubles; from this bad stuff. Please come to my porch and hear the noise of silenc e no-more --Come to my mailbox and be blown away every time and every minute while the Mining Trucks like Kilgore; but mostly their trucks go whizzing by me; almost sucking me off the spot where I get my mail. Come into my kitchen, the farthest place in my home of 35 years in May of this year., ((A rural life is for me. Fresh country air and a family to raise. 2nd and third generations;)) (I’m thinking ahead. will enjoy this farm;)if anything is left. We have mentioned before how we feel about our West Mountain being ripped apart. Wetlands and aceit artifacts ruined or in harm’s way. Our opinion is without compance or restoration of present mining activity; we do not see from our front door (bird’s eye view) stones thrown. The Kilgore mine; should not have any more expansion. We feel like they’ve made us collateral damage in every quality of our life.; long enough,, We would like to live a long healthy life as we intended out here over 35 years ago.. DAQ Response to Comment G1: The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit. Comment G2 – Received on January 25, 2023 January 23, 2023 Bryce C Bird Director Utah Division of Air Quality 195 N. 1950 E Salt Lake City, UT 84116 Re: Protest Letter for DAQE-INI58520002-22, Kilgore To Whom It May Concern: This protest letter is in response and objecting to Kilgore’s latest NOI regarding the modifications to the Approval Order for the Kilgore Benjamin Quarry Aggregate and Asphalt Processing Plant. As residents since June 1990, we are concerned about the negative impact of increased production and emissions this mine specifically has had and will continue to have on our home and farm as well as other residents in the area. This letter addresses the issues that we see as recurring and most likely continuing into the unforeseeable future. We suspect that unless both the DAQ and DOGM do what they were created to accomplish for the public safety, we will continue to see mining operations pollute and destroy our environment and communities. 27 It appears that anything contained in previously submitted NOI’s have been proven to be non- enforceable or only partially enforceable with Kilgore always getting the benefit of the doubt and a thumbs up to continue their negligible behavior. The impact of Kilgore’s mining practices on the community affects multiple areas. These failed practices are a result of the lack of proper procedural and enforcement issues on the part of local and state government agencies that have jurisdiction over the mining industry. It is understood that the DAQ does not regulate the mining plan. (We would like to know if anyone does.) Since this is the case, how are we to ascertain compliance with anything in Kilgore’s NOI? It is wrong that DAQ does not look at nor care about the cumulative effect of more than one mine in a particular area. And the air quality of the area they are using needs to be the standard and not another community 50+ miles away with no mines or even a single mine. The assessment of cumulative impacts in EPA review of NEPA documents states “The combined, incremental effects of human activity, referred to as cumulative impacts, pose a serious threat to the environment. While they may be insignificant by themselves, cumulative impacts accumulate over time, from one or more sources, and can result in the degradation of important resources.” EPA 315-R-99-002/May 1999. There is an obvious absence of anyone in a governmental position who seems to be concerned about the cumulative effect of 7 mines existing in a small area (West Mountain); three of these appear to be inactive at the moment but have not been reclaimed so fugitive dust is still an issue and nothing is being done to mitigate the problem. There are problems with both fugitive dust from disturbed areas as well as from the roads being used to haul products. • Staker Parson Keigley, 224.2 acres (located on 5 parcels – 34.24, 16.34, 120.49, 655, 40 acres) • Kenny Seng 105 acres – total involved acreage 129.5 • CMC Rock (150.22-acre parcel almost completely disturbed using Utah County Parcel maps – none having been reclaimed) How much are they being able to mine? Are they being monitored to make sure they are not mining more than this? It is not easy to determine since nothing has been reclaimed. • Payson City Landfill has 3 parcels, 82.37, 40 & 164.3 acres • Condie Construction has access to 2 parcels – 160 and 110 acres of US land they have disturbed. Supposedly 15 acres is what they have listed as disturbed; but looking at the map it is obviously way more than that. Kenny Seng permit alone allows 4680 total trucking hours. If you add up all the trucks allowed by all the mines on West Mountain, the number is huge. Mining operators on West Mountain are required to submit traffic plans for the number of trucks that will come to their pits and the routes the trucks will take to the freeway. These plans are not binding. (Mining operators can run more truck trips than their submitted plan.) The traffic plans are submitted as a yearly average of one- way truck trips per day. With the submitted plans and an estimation of the pits that are not required to have a plan submitted, estimating on the low side, West Mountain may have a minimum of 400 one-way trips per day. Since this is a daily number for a yearly average, some days the truck traffic is less and other days it is much more. taking the 400 daily trips for 365 days means that West 28 Mountain can have 292,000 one-way truck trips on their roads in one year. Because the truck trips are actually two trips-one to the pit and one returning-the number becomes doubled to 584,000 one-way trips. Residents have contacted local enforcement agencies, county commissioners, Utah Department of Public Safety, and Payson City due to road safety concerns. Accidents have occurred on many of the West Mountain streets that involve gravel trucks. There have been gravel trucks that have passed school buses with the lights flashing with several close calls of children being hit. Gravel trucks have tipped over on streets and into residents’ yards. Bikers have crashed due to the buckling on the roads caused by the large gravel trucks. Vehicles have had to pull off the road onto the shoulder to prevent crashes with trucks in their traffic lane. Adding more tonnage that Kilgore can mine, increasing the asphalt production amount and thus needing more supplies delivered to Kilgore, and controlling the fugitive dust by water trucks all increase the road traffic. The DAQ needs to take responsibility for what they are approving. It does not simply involve the emissions in the air. These totals need to be monitored by the week and month. Since the PTE is only partially enforceable, the figures need to be based on full capacity operation and year-round operation. Kilgore states in their NOI with the DAQ they plan on controlling fugitive dust by using water trucks to spray instead of using a sprinkler. The amount of water needed to control the plan is not specified. DAQ and/or State of Utah may be assuming that it is not feasible to specify a minimum amount of water due to change of environmental conditions and therefore no water specifics are required; this is not a reasonable excuse for not specifying water usage. Precipitation in a specific area could be incorporated into the amount of water Kilgore is using on a daily basis. There is .66 cubic yards approximate to one ton of aggregate. If Kilgore mines the 800,000 tons per year as outlined in the changes to the NOI, they could mine up to 528,000 cubic yards. Maricopa County in Arizona requires their mining operations to use a minimum of 30 gallons of water for dust control for every cubic yard mined. Using these figures and applying to Kilgore’s operation to feasibly control their fugitive dust, it would require 15,480,000 gallons of water. Most water trucks carry 2,000-4,000 gallons of water. If 4,000-gallon tankers were used to truck water to the site, Kilgore would need 3,870 loads per year. Even if this computed figure was reduced by half due to less cubic yards mined or increased precipitation, the truck trips would still be 1,935. Realistically, how feasible is it for Kilgore to control all of the mining dust, roads, and stockpiles by hauling water onto the site? The current AO that requires Kilgore to use a sprinkling system should be kept in place. Only areas that reasonably cannot be controlled by sprinkler should be considered for dust suppressant by the water trucks. The sprinkling design system may need to be redesigned to control as much of the dust as possible. The decision to abandon the sprinkling system is not the best BACT for the dust control. This will only increase the road traffic (which increases fugitive dust emissions) and will be completely inadequate. There is no doubt that the best BACT for air quality is reclamation. BACT/BACM should include a provision that disturbed land should be minimized and immediate reclamation of all disturbed lands sufficient to eliminate emissions should be the preferred dust control measure. DAQ should consider the approach adopted by South Coast Air Quality Management in its fugitive dust rule as a BACT consideration to establish a vegetative ground cover within 21 days after active operations have ceased. Ground cover must be of sufficient density to expose less than 30 percent of the unstabilized ground within 90 days of planting, and at all times thereafter. 29 Additionally, West Mountain has over 90 documented rock art. The Kilgore Benjamin mining operation is close to many of these petroglyphs. The effects of air pollution on petroglyphs are currently being studied. The area should be protected as an historical site and not be an unprotected casualty of industry and business. There are numerous health concerns when it comes to mine operations. There has been an increase in the arsenic levels in wells that are being drilled. Our previous home built in 1999 had no arsenic issues. Our current well drilled in 2020 would not pass after three attempts. We had to pay for a special filter for the arsenic. Since then, the county has decided to change the limits to a higher percent because wells being drilled were all too high to pass. Obviously, it is easier for them to increase the limit than to deal with the actual problem – fugitive dust leaving toxic particles that seep into the water aquifer creating this problem. It takes time for these toxins from the fugitive dust to filter down to the aquifers. I suspect that in future years West Mountain specifically will be seeing much higher arsenic levels in well water. And since the seepage doesn’t happen quickly, by the time it is noticeable, there is far more damage in the making than in the actual numbers as there is arsenic that hasn’t yet made its way to the water aquifer. Water sources must be protected. There is also a substantial increase in the incidents of disease among residents. This has been proven in multiple studies. Research well documents the health hazard of the particulates and gases found in fugitive dust from aggregate mining and emissions from asphalt processing plants. Pollutants increase the risk for heart attacks, heart failure, stroke, neurological diseases like dementia, lung disease, ectopic pregnancies, cancer, and type II diabetes. As residents, we are exposed daily to the fugitive dust and asphalt byproducts. We protest any additional increase in the amount of exposure we have to these harmful substances. We are owners/operators of a 32-acre u pick farm just south of Kilgore. We currently grow sweet cherries, apricots, pluots, peaches, apples, raspberries and blackberries. We are planning to introduce more u pick varieties. One of the biggest issues of mines is the proliferation of dust mites due to the increased amount of fugitive dust in the area. Dust mites thrive on the fugitive dust that settles on orchard leaves and fruit. They can cause a loss of crops and trees. It is not economically feasible or reasonable or healthy to spray constantly to control this problem. This is not even considering any impact on the beehives needed for proper pollination in the orchards. We understand that mining operations are needed for the economic growth of an area. However, one industry cannot operate at the expense of another. The fugitive dust on West Mountain needs to decrease to protect the area’s orchard industry. What happens on mining property, CANNOT spill over to adjoining properties. We have been told that details outlined in the NOI with the DOGM to reclaim are enforceable. But it hasn’t been proved that it is being enforced. Kilgore has not started reclamation and is already in Phase B. Kilgore has 22.5 acres disturbed ground now. Our experience as a community is that it is very difficult to ensure existing requirements are closely being monitored by Utah divisions that regulate mining operations. Vague language and amendments to existing permits allow loopholes in the system that can be used to a mining operation’s advantage. Violations are not immediately rectified. In some cases, years can go by before something is correc ted or brought back to the standard required in the permits. We appreciate the work and efforts of our state employees, but they often have too large a workload and not enough employees to catch all the infractions. 30 There are many questions that arise as we research information regarding mining operations. Here are a few questions that need to be addressed: • Water is consumptive so what of the 33.88-acre feet assigned to Kilgore’s water right is going back into the aquifer and how much is being wasted through evaporation? Well Information: Water Right No. #57-10432, Change application No a42615 From East Jordan Irrigation Co. (comes from out of the lake) 33.88 acre feet consisting of 2 wells northwest of Kilgore’s current location. Industrial use approved – a little domestic for office and the rest for dust mitigation, etc. Filed for in 2017. Extension requested to proof up well. They have until Oct. 31, 2031 to proof it up. • No baseline is established for determining the data. If there is no baseline, how can anything be accurately measured or determined? • Blasting plume measurements was decreased from 70 feet to 50 feet. How can this possibly give an accurate reading of these plumes? • Kilgore is asking to increase their disturbed area. Yet PM10 figures are lower with this new NOI. How can the numbers go down when the area being mined is increasing? • Kilgore has not fully complied with regulations and NOIs in the past. How can we believe they will do so in the future? • Did Kilgore build the silo for the fly ash without a permit? If so, why is this okay? • What is the limitation put on Kilgore, if any, due to them nearing threshold limits in accordance with their current DAQ permit? When Kilgore expands their emissions/acreage, will those stipulations be lifted? • Why are DAQ and DOGM not more closely aligned to ensure NOI enforcement? If Kilgore and the DAQ cannot give a definitive answer for the effect of their fugitive dust/asphalt emissions on the community as per single mining operator and as part of the group of numerous mines that all affect the same area, then they should have definitive accountability. This amendment to Kilgore’s AO with the DAQ should not be approved. The DAQ and Kilgore have the responsibility to establish a baseline of current air quality in the geographical area of West Mountain specifically, not at a monitor placed in Provo or Lindon. 31 Well water and soil should also be tested to establish a baseline. Then, the DAQ and Kilgore should yearly test these items to prove that they are indeed not impacting and affecting the community negatively. We oppose the approval to amend Kilgore’s current AO with the DAQ. DAQ Response to Comment G2: The commenter has expressed concern over the increased truck traffic and Kilgore’s water usage. The DAQ does not have the authority to regulate vehicle traffic on public roads, including the requirement for trucks to follow local and state traffic laws. Similarly, the DAQ does not have the authority to regulate Kilgore water rights and usage. Water rights, including applicable well information, do not fall under the DAQ jurisdiction. Therefore, inquiries related to water rights need to be directed to the appropriate agency. The commenter did not provide what authority DAQ has to regulate water and traffic issues. The DAQ only has authority over air quality permitting issues. Specifically for this permit to regulate the particulate matter, the DAQ can impose opacity requirements and controls applicable to fugitive dust emissions. Kilgore must meet the opacity requirements in the permit and ensure it has sufficient water to do so or be subject to enforcement action by the state. The comment asks how the decrease in blasting plume measurements from 70 feet to 50 feet can give an accurate reading of these plumes. Please see DAQ’s Response to Comment M10 for details on plume measurements. The comment asks why the emissions of PM10 are lower in the NOI when Kilgore is asking to increase disturbed area. The entire site-wide potential to emit was recalculated by Kilgore using the most up-to-date emission factors and guidance. Kilgore’s calculations were verified and accepted by the DAQ. Per the Summary of Emissions table on page 4 of the ITA, PM10 emissions are not decreasing. The requested changes will result in an increase of 5.99 tons per year of PM10 and 2.29 tons per year of PM2.5. The commenter has expressed concern with Kilgore’s compliance history. The DAQ compliance section is responsible for ensuring that all regulatory requirements are met for major and minor sources on lands under the state’s regulatory jurisdiction. The compliance section conducts inspections, audits, and enforcement actions as authorized by the Utah Air Conservation Act, Utah Code §§ 19-2-101 to 19-2-305, and applicable regulations promulgated under the Act. Utah businesses or sources that emit air pollutants are inspected to ensure that they are complying with the permits issued by DAQ and any other applicable federal and state regulations. DAQ rules and policies are intended to achieve voluntary compliance and to provide consistent application throughout the state. The DAQ encourages continuous compliance, and provides a mechanism for documentation if formal enforcement action is necessary. Compliance inspections have been conducted at this source location three times since the current Approval Order was issued on November 29, 2018. The source location was found to be out of compliance with the Approval Order during an inspection conducted on July 21, 2021. As pointed out by the commenter, an unapproved fly ash silo was observed at the source location during the inspection. Based on this inspection, compliance action was initiated which resulted in a financial penalty and Kilgore working with the DAQ to modify its Approval Order to account for the 32 emissions from the fly ash silo. The DAQ will continue to inspect this source location at an increased frequency to ensure compliance with the conditions of the Approval Order. The limits set in the Approval Order are not to be exceeded without prior approval. The Approval Order is a legal document that contains conditions that Kilgore must comply with or be subject to enforcement action and financial penalties. The commenter questioned why DAQ and DOGM were not more closely aligned to ensure NOI enforcement. The DAQ recognizes interagency coordination as an important tool in protecting Utah’s resources. Regulation and enforcement of air quality standards strictly fall under the jurisdiction of the Division of Air Quality. DOGM regulates the exploration and development of coal, oil and gas, and other minerals. Therefore, each agency serves an important and unique purpose, and each has its separate authority to regulate industrial activities in the state. Coordination between the agencies is encouraged, and is done according to Utah law. The commenter also had concerns about the selected air monitoring station. Please see the responses to comments M1 and M2 explaining the choice of the monitoring station. Lastly, the commenter suggests that well water and soil should also be tested. The DAQ only has authority over air quality requirements only. It does not monitor well water or soil, nor does it implement the requirement for a source to do so. The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit as a result of this comment. Comment G3 - Received on January 25, 2023 Bryce C Bird Director Utah Division of Air Quality 195 N. 1950 E Salt Lake City, UT 84116 Re: Protest Letter for DAQE-INI58520002-22, Kilgore To Whom It May Concern: This letter is in opposition to Kilgore’s latest NOI regarding the modifications to the Approval Order for the Kilgore Benjamin Quarry Aggregate and Asphalt Processing Plant. We have lived in West Mountain for nearly twenty years. In that time we have seen many changes, some for the better and some for the worse. The mining situation on West Mountain definitely falls in the later category. It has gone from bad to worse, and it seems that as citizens who live here our voice is not heard. There are many issues with this AO that I see as red flags and reasons why it should not be approved — 33 •Dust— There are SEVEN mines in a very small geographical area. The wind blows almost constantly along the base of the mountain and at any given time there is a line of dust trailing into the sky coming from the mines, depending on the direction of the wind. This dust contains particulate matter that is very harmful to water, soil, animals, plants, honeybees and most especially for human to breathe! •Dust mites and beehives- dust mites are a real threat to our agricultural community, not only for the farmers who grow crops and family gardens like we do but also for beekeepers. We used to have nearly a dozen beehives, but slowly they began to die and dust mites was a big cause. Do you understand the necessity to ensure the success of bees? Bees are responsible for pollinating more than half the produce grown in the US. When we let commercial minin g activities overstep their boundaries and impact the farming and rural communities, it has far reaching effects in our food production and society. Small decisions have long term consequences! Please make your decision with the future health and well-being of our community and Utah at large in mind. • Air Quality— I understand that air quality monitors are set up in Provo 20 miles away, but they are not nearly close enough to the mines and they don’t gather information about the CUMULATIVE effect of those seven mines’ dust that we are breathing every single day! I have a daughter with asthma and I am very concerned about the quality of the air she (and my family) breathe as she is susceptible to lung issues very easily. • Water resources — With the fugitive dust comes the need for extra water needed to mitigate the dust. Are you aware that many families in the Benjamin and West Mountain area have had their wells run dry and have been forced to dig new wells at great expense? We were in that situation a few summers ago. We had several days during the summer where our well was running low on water and when we turned on the tap NO WATER CAME OUT. That is terrifying as a parent to not have water for my family. If Kilgore expands and mines more of the mountain and creates more dust, it will need to use more water to mitigate the dust. From what I have read they are not in compliance with their dust suppression as it is, why would we grant them more land to mine if we know they aren’t abiding the agreement they already have? •Highway traffic— with seven mines running literally hundreds of truck trips each day, we have a CONSTANT AND STEADY stream of trucks with dump trailers on our roads, especially on 5600 West, 7300 South, 9600 West, and 10400 South. Those are the main thoroughfares to the freeway. This is a serious public safety issue, not to mention infrastructure and road issues. Right in front of my house, I have personally witnessed a truck pulling two side-dump trailers ignore a school bus driver with the flashing lights on and the STOP sign out. They drove right past the bus, in between my children and the bus. It was terrifying!! Thankfully my kids and the neighbor children with them heard the bus driver yelling at them to move back and they obeyed her. It could’ve easily been a tragic situation! Last month (December 2022) we had a terrible crash involving two trucks on the highway (5600 W) right in front of my house. One truck rolled multiple times and ended up in the ditch and another ended up in a hay field with one of its trailers rolled over. The truck’s trailer fishtailed so violently and swerved off the road that it nearly missed hitting my 500 gallon propane tank. It was a terrible accident and we are grateful that miraculously the drivers weren’t seriously injured. 34 • Ancient Petroglyphs on West Mountain — there are dozens of ancient Native American petroglyphs on West Mountain near the Kilgore site. These are Petroglyphs are supposed to be protected by the government, but sadly they aren’t. With each expansion from Kilgore, they are more and more at risk of being disturbed and destroyed from all the pollutants and encroachment. I sincerely hope that you will take into account the issues that we see as recurring and most likely continuing into the unforeseeable future. I believe that unless both the DAQ and DOGM do what they were created to accomplish for the public safety, we will continue to see mining operations pollute and destroy our environment and communities. Why do we have a Dept of Air Quality if you will not enforce infractions when they occur and continue to approve expansions even when the evidence clearly shows the harm to the community? We oppose the approval to enlarge the Kilgore mining operations for the many reasons stated above. Please consider these requests and do the right thing by the people in our community. DAQ Response to Comment G3: The commenter has stated that Kilgore is not in compliance with dust suppression and consequently, no further mine expansions should be granted. As the commenter has pointed out, Kilgore was found to be out of compliance with the conditions requiring the installation of water sprays during an inspection conducted on July 21, 2021. Based on this inspection, compliance action was initiated which resulted in a financial penalty and Kilgore working with the DAQ to modify its Approval Order. The dust has not been observed to exceed the opacity limits in the Approval Order during any of the three inspections that have been conducted since 2018. Please see DAQ Responses to Comments C1 and G2 for details. Compliance inspections have been conducted at this source location three times since the Approval Order was issued on November 29, 2018. The DAQ will continue to inspect this source location at an increased frequency to ensure compliance with the conditions of the Approval Order. The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit as a result of this comment. 35 Comment G4 - Received on January 27, 2023 January 23, 2023 Bryce C Bird Director Utah Division of Air Quality 195 N 1950 E Salt Lake City, UT 84116 Ref: Kilgore Benjamin Quarry Aggregate and Asphalt Processing Plant Subject: Protest Letter for DAQE-INI58520002-22 We are submitting our comments regarding the modifications to the Approval Order for the Kilgore Benjamin Aggregate Quarry and Asphalt Plant. Johnnie & I have lived in West Mountain for over 20 years. We are concerned about the negative impact of increased production and emissions on our family and other residents in the area. We are opposed to this approval for many reasons and have concerns regarding some of the modeling criteria that were reduced. We also have concerns that regulations are not being enforced. Regulations and conditions may look good on paper, but if a mining operation is not in compliance with them or if the calculations used to make decisions are not accurate, they are not providing the protection needed nor the control of the pollution as necessary to protect the health and safety of our community. Does what we are seeing in the air we breathe correspond with what you are showing in the below chart or is it the result of the lowest journal pollution that could be found? We can’t see gasses making it imperative that the numbers used in modeling are based on the best scientific information available 36 Does DAQ compliance have the technology or means to verify and confirm Kilgore is in compliance with II.B.3.a? This is from the original AO. Requirements of DAQ’S approval order II.B.3.a The owner/ operator shall not exceed the following: A. 12.00 acres of storage pile and disturbed ground combined C. 6,700 feet (1.27 miles) of unpaved haul roads. [R307-401-8] II.B.3.a.1 Compliance shall be determined through GPS measurements or aerial photographs. Reclaimed areas such as those with emerged vegetation or hydro-seeded do not contribute to the acreage totals. [R307-401-8] Kilgore’s air quality plan permits 12 acres of disturbed land. Kilgore submitted the below map to the DAQ Dec of 2022. Kilgore’s documents state they have disturbed 14.84 acres. Kilgore is out of compliance. 37 Kilgore admits to being out of compliance. The inspection was done in August 2022. Why didn’t the DAQ compliance on site inspection report document that Kilgore was not in compliance? Why didn’t DAQ compliance require Kilgore to account for all disturbed land and stock piles not on the map which was submitted? 38 Are all the areas marked with yellow accounted for? that they have deducted areas from the disturbed land and stock piles. One of the deductions is for huge storage piles of RAPS. Why aren’t the HUGE storage piles of shredded recycled asphalt being counted? They are eroded by the wind and rain and when being moved. Particulate matter is not the only concern. RAP contains natural aggregate and bituminous asphalt, a material that contains heavy metals and poly-aromatic hydrocarbons (PAHs). Heavy metals and PAHs are pollutants that have been identified as carcinogenic, mutagenic, and teratogenic. When ground into small pieces, these pollutants will be picked up by the wind and become fugitive dust. 39 40 The above image shows Kilgore’s RAPS piles marked by red. AP-42 Chapter 13.2 defines storage piles as “inherent in operations that use minerals in aggregate form” that are “usually left uncovered, partially because of the need for frequent material transfers into or out of storage”. AP-42 Chapter 13.2 also states that “Total dust emissions from aggregate storage piles result from several distinct source activities within the storage cycle: 1. Loading of aggregate onto storage piles (batch or continuous drop operations). 2. Equipment traffic in the storage area. 3. Wind erosion of pile surfaces and ground areas around piles. 4. Loadout of aggregate for shipment or for return to the process stream (batch or continuous drop operations).” Kilgore’s map has this area marked with a diamond shape and the key reads it is a deducted area. Why? Why is this .53-acre RAP’s storage pile not being accounted for? 41 The below 1.17 area of disturbed land is not even included on Kilgore’s map. We know it is there. It has been a source of fugitive dust every time the wind blows. Why hasn’t Kilgore included it on their map? Kilgore has not accounted for the below area of disturbed land. This identifies the problem of using an aerial photo to calculate disturbed land of the high walls. These high walls are hundreds of feet 42 tall. How is kilgore measuring the surface area of all the high walls that are hundreds of feet tall? In an aerial photo, a vertical high wall looks like a straight line! The below image was taken by drone and clearly shows a high high wall not visible on Google maps in a plottable mode that is accurate; What technology did Kilgore use to measure all the surface area of the high walls? The below image is from google earth from a plottable view. It is of a high wall with steps that is hundreds of feet high. How is Kilgore measuring these disturbed areas? 43 The below image is another high wall. How did Kilgore measure this? 44 The image below was created using Google earth and used on 12/22 to plot the disturbed acres; it calculated 47.72 acres. Also had a friend plot the same area using Map Developers. They were within 1.15 acres. 45 Who decides and/or interprets this important definition that determines if disturbed land is accounted for and used as part of the calculation to establish how many TONS of PM fugitive dust it is estimated will be released into our air. Decisions to protect the public’s health are based on this calculation. Definition of disturbed area; AP-42 Chapter 11.9 defines the disturbed area as existing “from the time an area is disturbed until the new vegetation emerges, all disturbed areas are subject to wind erosion. “ Chapter 13.2.5 states “a disturbance is defined as an action that results in the exposure of fresh surface material.” This area does not include haul roads, or areas in which “fresh surface material” is not exposed. Disturbed areas, therefore, would not include the HMA plant working area, haul roads, areas where equipment is stationary, or paved areas. 46 AP-42 Chapter 13.2 defines storage piles as “inherent in operations that use minerals in aggregate form” that are “usually left uncovered, partially because of the need for frequent material transfers into or out of storage”. AP-42 Chapter 13.2 also states that “Total dust emissions from aggregate storage piles result from several distinct source activities within the storage cycle: 1. Loading of aggregate onto storage piles (batch or continuous drop operations). 2. Equipment traffic in the storage area. 3. Wind erosion of pile surfaces and ground areas around piles. 4. Loadout of aggregate for shipment or for return to the process stream (batch or continuous drop operations).” Each of these definitions contradict each other. One states a disturbance as existing “from the time an area is disturbed until new vegetation emerges;” the other defines a disturbance as an action that results in the exposure of fresh surface material. Does the original definition include the below statement or is it the interpretation of the DAQ?: “This area does not include haul roads, or areas in which fresh surface material is not exposed. Disturbed areas therefore would not include the HMA plant working area, haul roads, areas where equipment is stationary, or paved areas.” The above statement, “This area does not include haul roads, or areas in which fresh surface material is not exposed. Disturbed areas therefore would not include the HMA plant working area, haul roads, areas where equipment is stationary, or paved areas.” is the DAQ’s interpretation based on guidance from EPA. As mentioned in previous responses, disturbed area is calculated using guidance found in AP-42, Chapter 11.9. Haul road PM10 and PM2.5 emissions are calculated using emission factors from AP-42 Section 13.2.2 for Unpaved and Paved Roads . Emissions from the HMA plant area is based on emission factors from AP-42 Section 11.1 for Hot Asphalt Mix Plants. Therefore, haul road emissions and HMA plant emissions are not counted as disturbed areas, but are evaluated separately Additionally, areas that are paved or hold stationary equipment do not typically have freshly exposed surface materials and/or are not frequently disturbed. Regardless if DAQ added this or if it is in the definition, it is ridiculous. Anywhere there is exposed dirt that the wind touches it is potential fugitive dust. Every time a diesel drives on the haul road dirt is disturbed! 47 DAQ Director should consider the economically and technologically feasible approach adopted by South Coast in its fugitive dust rule, BACM/BACT Apply water to at least 80 percent of all inactive disturbed surface areas on a daily basis when there is evidence of wind driven fugitive dust; or, Apply dust suppressants in sufficient quantity and frequency to maintain a stabilized surface; or, Establish a vegetative ground cover within 21 days after active operations have ceased. Ground cover must be of sufficient density to expose less than 30 percent of unstabilized ground within 90 days of planting, and at all times thereafter; or Utilize any combination of control actions above such that, in total, these actions apply to all inactive disturbed surface areas. BACT/BACM should include a provision that, at Kilgore, disturbed land should be minimized and immediate reclamation of all disturbed lands sufficient to eliminate emissions should be the preferred dust control measure. I contacted DAQ compliance in 2020 and told them I was very concerned about the fugitive dust I was seeing leaving Kilgore’s boundaries. I asked if DAQ had confirmed that Kilgore was in compliance with having the permitted 12 acres of disturbed land and stockpiles. This is the answer I got 48 The below reply from DAQ compliance is regarding inspection of disturbed land during the April 2020 Inspection; 49 The amount of disturbed land and storage piles is used to calculate the tons of PM pollution released into the air we breathe. If Kilgore is not in compliance, MORE PM’s than DAQ has approved is in our air. This is especially important to us since we live in a nonattainment area; an area that has 7 mining operations and a landfill. No modeling was done on the surrounding area. No one knows how much cumulative hazardous pollution this community is breathing. The closest monitor is Provo. Instead of doing ambient modeling in Provo it was done in Lindon. Kilgore has taken so much from us our scenic view, our blue sky, our quiet country ambience. Now we share our small country roads with HUNDREDS of diesel trucks. The pollution they are permitted to create and release into the air we breathe is a threat to our families’ health. It is not expecting too much for Kilgore to be in compliance with all of their required permits. This is not the case. Kilgore has a history of not being in compliance; 50 To date, instead of complying and using the BEST method of control, Kilgore is requesting control of PM air pollution on 18 acres of stock piles with diesel trucks spraying water and spewing toxic diesel exhaust. This technique falls short of being the best method for many reasons. Control efficiencies used for modeling are 66%-54%-40% Does Kilgore have the means & enough water to successfully accomplish them? **Steep terrain makes many stockpiles inaccessible. **Height of stockpiles **Using diesel trucks to control PM pollution would create an even more hazardous pollutant: Diesel exhaust! 51 The detrimental impacts of diesel exhaust are well documented; they have been proven to cause disease, environmental impacts and Global warming. Using Diesels instead of trucks is not BACT. The director should not approve this AO. Will DAQ compliance be permitted to drive on all haul roads and confirm they have been covered with road base to ensure the 95% efficiencies are achieved? 52 There were significant changes made for modeling: * changing the amount of hazardous pollutants created by blasting * changing the size of the plume from 75 ft to 50ft DAQ When I submitted information on comments that I provided on Kilgore’s previously approved OA, I was informed that the DAQ only considers information from approved sources. My understanding is that these huge changes to modeling were based on a paper that was published and peer reviewed. According to information provided by the DAQ, Kilgore’s request to drastically reduce the amount of HAPS into the air is based on the report at the following link: https://www.sciencedirect.com/science/article/abs/pii/S1352231008006390 DAQ must take into consideration that Peer-reviewed work isn’t necessarily correct or conclusive. Peer review is defined as evaluation of an article by one or more persons whose expertise is similar to that of the investigator(s)/author(s). All we know is that at least one person evaluated the article. Research passes through peer review and is published. Science must deal wit h it somehow — perhaps by incorporating it into the established body of scientific knowledge, building on it further, figuring out why it is wrong, or trying to replicate its results 53 Have the reported results been replicated and proven in multiple studies? Is this a conflict of interest; Drummond Rennie: there seems to be no study too fragmented, no hypothesis too trivial, no literature citation too biased or too egotistical, no design too warped, no methodology too bungled, no presentation of results too inaccurate, too obscure, and too contradictory, no analysis too self - serving, no argument too circular, no conclusions too trifling or too unjustified, and no grammar and syntax too offensive for a paper to end up in print.1 This statement was made in 1986 in the announcement of the first International Congress on Peer Review. Did the engineer evaluate these assumptions? Where can we read them? Why didn’t the engineer require additional testing? With the track record of compliance you have been shown, I would hope you agree that this radical change is too important to just require monitoring, record keeping, or reporting to ensure the assumptions in the permit are correct for this site. The below is from the DAQ project file. 54 55 Here again the DAQ has permitted Kilgore to use the lowest calculation they could find in a Journal. Where is DAQ’s due diligence supporting the credibility of this Journal report? Where on the AO are the conditions Kilgore needs to follow to achieve the exact same results used in modeling? If these are not in place it would seem you are using our families as guinea pigs & collateral damage. According to information provided by the DAQ, Kilgore’s request to drastically reduce the amount of HAPS into the air is based on the report at the following link: https://www.sciencedirect.com/science/article/abs/pii/S1352231008006390 The DAQ will not be onsite to verify compliance. Even if they were, I read it is not possible to measure the HAPS in a blast plume. 56 57 58 4.1.3 The Benjamin Pit haul roads are wide enough for two lanes of travel, but haul truck travel frequency will be sparse enough that plumes from multiple trucks will not regularly combine. Therefore, the single lane calculation was used for development of haul road volume source parameters. In the above comment 4.1.3, Modeling noted that due to scant traffic, only one lane and no overlapping dust was used for modeling. Based on production of 800,000 tons per year that would be 7 trucks per hour; 56 trucks a day per an 8-hour day, 5 days a week for a year of 2,000 working hours = 14,000 trucks If the Benjamin pit is closed any day for any reason, the number of trucks per day goes up. If Kilgore is slow during the winter months the number of trucks increases exponentially for the remaining months. Considering that Kilgore has 1.27 miles of unpaved haul roads, this amount of traffic surely will have traffic in both lanes. This certainly does not fit the definition of “sparse” *Why was Lindon used for ambient air instead of Provo-Does Lindon have 6 mining operations and a landfill within a 6-mile corridor? 59 This map chart was included in the Study done by Utah County DISTURBED PARCELS = 2658.0 acres of land that will be mined. What is the size of storage piles used in modeling? PM pollution will not be the same for a 20-foot storage pile as a 100-foot storage pile. What is the size of storage piles used in modeling? If approved will Kilgore be permitted to have as many storage piles as will fit on 18 acres with no limitation of the height? 60 DAQ was not consistent in the modeling with how the AO reads. Modeling reads 6 acres of storage piles and 1 acre of disturbed land. AO reads 18 acres of storage piles and 1 acre of disturbed land. How does this affect the calculations? Hazardous Pollution from other mining operations are not required to be included in DAQ’s modeling. How are our families protected from the cumulative pollution from the 7 mining operations and land fill on a 6-mile corridor on West Mountain? CMC Rock, LLC/CMC West Mountain 150.22 acre Kilgore 94 acres Condie Const Co 270 acres Double C LLC 160 acres Utah County landfill 286.67 Kenny Seng 129.5 acres Staker Parsons Kiegley mine 377.4 acres 1,467.79 acres 61 Due to disturbed parcels mining will be permitted to expand onto the 2658 acres. Kilgore’s permit with the DOGM is contingent on concurrent reclamation taking place Within five years of mining the permit area. The NOI was transferred to Kilgore in 2015. 2020 was the fifth year. Kilgore is more than half way through the 5-10 years shown on the below chart requiring 19.1 acres reclaimed. TOTAL RECLAIMED IS ZERO. 62 I think it is important that the DAQ understands that the DOGM does not shut down mining to enforce reclamation to be done. Utah ‘s mining operations are not mining one phase and reclaiming the land before moving onto the other. If that were the case we would not have mining operations with the enormous amount of disturbed land. Look around Kennecot, Point of the Mountain, Pelican Point, Staker Parsons. They are in the mining business and they mine until there is nothing left to mine. As long as DOGM has a bond to cover the cost of reclamation when the mine is mined out mining goes on unhalted. As long as DAQ leaves reclamation totally up to the DOGM, our air quality problems will not be resolved efficiently. Air quality plans will continue to use our scarce water to control disturbed land with less efficiency. How did I come to this conclusion? I asked the DOGM. Answer is below: Why is mining being done on Phase B before grading has begun Because they bonded for 94 acres and mining plans change all the time. Why has no reclamation been done + Statement about concurrent reclamation having to take place within 5 years. While they have stated this, when they are appropriately bonded for 94 acres I cannot strictly hold them to their phased plans (and plans change). Operational plans for us are usually primarily informational to help us determine a bond based on total acreage they’ll disturb, unless they are only bonding for a smaller portion of their entire area. In this case Kilgore has bonded for the entire 63 area. I have confirmed with the BLM, as you know they are one of the land owners involved, and they also don’t have any issue with this phased plan being strictly followed when we have plenty of bond. As for the 5 years, I don’t have a good answer for you. As far as we are concerned this is their plan that may or may not happen depending on how mining goes. They also do not clearly state what year they mean, it could easily be interpreted as within 5 years of finishing disturbing the entire site. They also have an asterisk stating that the plan can change due to supply and demand. Again, the permit only states they have to begin grading phase A before they can mine/disturb Phase B. With wording like that even the most minimal amount of grading in one corner of Phase A would suffice. Conclusion so far I apologize that it’s probably not what you want to hear but operational plans are only a snapshot that we use to calculate a bond for the entire area. If they are not bonding for a small portion and then moving the bond around, but bonded for the entire area at once, there is not much we can do. At most we would probably just request they amend their plan slightly, but when they are only disturbing within their bonded boundaries I cannot issue a violation or shut them down. I hope this has clarified some things. There is no doubt that the best BACT for air quality is reclamation! DAQ Director should consider the economically and technologically feasible approach adopted by South Coast Air Quality Management in its fugitive dust rule, BACM/BACT Apply water to at least 80 percent of all inactive disturbed surface areas on a daily basis when there is evidence of wind driven fugitive dust; or, Apply dust suppressants in sufficient quantity and frequency to maintain a stabilized surface; or, Establish a vegetative ground cover within 21 days after active operations have ceased. Ground cover must be of sufficient density to expose less than 30 percent of unstabilized ground within 90 days of planting, and at all times thereafter; or Utilize any combination of control actions above such that, in total, these actions apply to all inactive disturbed surface areas. 64 BACT/BACM should include a provision that, at Kilgore, disturbed land should be minimized and immediate reclamation of all disturbed lands sufficient to eliminate emissions should be the preferred dust control measure. Using google earth I zoomed in close enough to verify vegetation, paved roads, haul roads, HMA plant working area,areas where equipment is stationary to avoid including them; Definition of Disturbed as provided by the DAQ ; Kilgore 2022 65 66 67 68 69 TOTAL OF DISTURBED LAND = 22.5 70 Kilgore is requesting to increase the amount of disturbed land and storage piles by 6 acres; from 12 to 18 acres. Granted Plotting on Google earth is an estimate. It does show enough disparity to the map that Kilgore’s submitted December of 2022 that I would think it should justify the DAQ determining how much land is disturbed before adding 6 more acres on to what plots out to be 22.5 acres. If this number is not accurate the TPY of PM’s is not accurate! My understanding is that if it can not be accurately measured and enforced it all MUST be counted! Visit Kilgore’s site at the following link. See the size of the stock piles and how difficult it would be to get a diesel around them to spray water to control the dust. Video was done during January when the mining is not in full operation. Notice the traffic on the roads. To bad full scale mining isn’t possible during the winter. The ground is saturated and there is not a fugitive dust problem. https://photos.app.goo.gl/owdk5PfVJNwX7HCY7 DAQ Response to Comment G4: Many of the commenters’ concerns and questions have been addressed in DAQ’s previous responses to other comments. Some responses have been reiterated here. The commenter has asked whether DAQ has the means to verify and confirm Kilgore’s compliance with Condition II.B.3.a in the draft permit. Condition II.B.3.a in the draft permit reads as follows: The owner/ operator shall not exceed the following: A. 18.00 acres of storage pile and disturbed ground combined B. 9,980 feet (1.89 miles) of unpaved haul roads This condition further outlines that “[c]ompliance shall be determined through GPS measurements or aerial photographs. Reclaimed areas such as those with emerged vegetation or hydro-seeded do not contribute to the acreage totals.” As such, the technology required to confirm compliance is available to the DAQ. The commenter asked why the DAQ compliance report prepared after the August 22 inspection did not report noncompliance and why Kilgore was not required to account for all disturbed land and stockpiles not on the map. Condition II.B.3.a of the Approval Order allows for 12.00 acres of storage piles and disturbed ground. Information provided during the August 22, 2022, inspection indicated the source had 11.7 acres of storage piles and disturbed ground and therefore was in compliance with this permit condition. All disturbed land and stockpiles, as defined by AP-42, have been accounted for in the map Kilgore prepared for the DAQ. The map prepared by Kilgore, which is the previous figure included in the comment, was submitted to the DAQ in December of 2022. The map has been reviewed and determined to account for all disturbed areas and storage piles as defined by AP-42. The areas marked yellow are not accounted for, as these areas do not fall within 71 the definition of disturbed area and storage piles. Please see DAQ Response to Comment P1 for the respective definitions. RAP piles are not counted as stockpiles because RAP is not an aggregate nor is it considered an emission source. The inherent nature of RAP piles is that they bind themselves together due to the asphaltic materials within the product and are not considered wind-driven materials or emission sources. Kilgore stores RAP at this location on an asphalt pad or on pavement until it is processed (crushed, screened, and transported via conveyor). RAP is processed occasionally throughout the year, as needed, to create processed storage and is used to subsidize the production of new asphalt in place of newly processed aggregates and asphaltic materials. The commenter has asked what technology Kilgore used to measure all the surface areas of the high walls. Kilgore conducted aerial drone assessments using DroneDeploy to measure all disturbed areas, storage piles, reclaimed areas, haul roads, etc. The comment has asked whether DAWQ compliance will be permitted to drive on haul roads to confirm that they have been covered with road base to ensure 95% control efficiency. Condition II.B.3.a of the Approval Order allows for 6,700 feet of unpaved haul roads. Condition II.B.3.a.2 of the Approval Order requires the entry haul road to be paved for no less than 3,000 feet. Conditions II.B.3.a.1 and II.B.3.a.2 require the source to maintain these measurements. These conditions are reviewed during source inspections to evaluate compliance. The commenter has expressed concern about the credibility of the articles Kilgore used to calculate emissions during drilling and blasting operations. The commenter also asked whether there are AO conditions that Kilgore needs to follow to achieve the same results that were demonstrated through modeling. The assumptions in the permit application are used as parameters to calculate emissions estimates and conduct modeling. As mentioned, the parameters used in these analyses are consistent with what is in the NOI. Peer review is an important procedure used by the scientific community to ensure the quality of published information. Because the articles have been reviewed by experts in the field, the assumptions will accurately reflect real-world conditions, and additional testing by the source is not required. The DAQ conducted modeling analysis for 24-hour PM10, 1-hour NO2, and annual NO2 levels, respectively. To ensure Kilgore’s operations were accurately modeled, Conditions II.B.3.k, II.B.3.k.1, II.B.3.l, II.B.3.l.1, II.B.3.m, and II.B.3.m.1 were added to the Approval Order to prevent exceedances of NAAQS. The commenter has asked DAQ to explain the reasons for using the Lindon monitoring station data in the modeling analysis instead of Provo even though Provo does not have the same 6 mining operations and one landfill near it as Lindon does. Please see DAQ Responses to Comments M1 through M3 for a response to this question. In addition, the North Provo monitoring location does not have 6 mining operations near it either. The 6 mining operations near Benjamin are outside the region where the sources are added to the model. The impacts from these facilities are considered to be insignificant near the Benjamin operations. The commenter asked about the size of the storage piles used in modeling. The storage piles in the latest model had a total area of 11.57 acres within the larger 18-acre area they are located in. 72 The commenter asked whether Kilgore will be allowed to have as many storage piles as will fit on the 18 acres without height or other limitations. Emission estimates from storage piles are based on the area, not volume, of storage piles. Emissions are based on emission factors for PM10 listed in AP-42 Fourth Edition Table 8.19.1-1 Storage Piles. These emission factors are expressed in pounds of particulate matter per acre-day. Therefore, the area (in acres) is used to regulate Kilgore’s operations. The commenter asked how emissions calculations will be affected with 18 acres of storage piles and 1 acre of disturbed land. The requested changes will result in an increase in 2.07 tpy of PM10 and 1.22 tpy of PM2.5 from stockpiles and disturbed area. Commenter requests that “BACT/BACM should include a provision that, at Kilgore, disturbed land should be minimized and immediate reclamation of all disturbed lands sufficient to eliminate emissions should be the preferred dust control measure.” The DAQ authority over land reclamation and mining operations is described in DAQ Response to Comment G2. Kilgore Benjamin pit has a DOGM permit (permit number M0490086). Any mine subject to a DOGM permit would have DOGM overseeing reclamation. The DAQ does not have the authority to order Kilgore to reclaim disturbed areas. Lastly, the commenter used Google Earth to obtain a rough approximation of the disturbed land. This method likely results in a large margin of error. Additionally, the DAQ cannot verify when these values were approximated. The operations at the Benjamin Pit are consistently fluctuating, and these images may be outdated or not accurately reflect what is considered “disturbed land.” The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit as a result of these comments. 73 Comment G5 - Received January 28, 2023 Bryce C Bird Director Utah Division of Air Quality 195 N 1950 E Salt Lake City, UT 84116 Ref: Kilgore Benjamin Quarry Aggregate and Asphalt Processing Plant Subject: Protest Letter for DAQE-INI58520002-22 Mr. Bird and Utah Division of Air Quality, This protest letter is being sent to you regarding the modifications to the Approval Order for the Kilgore Benjamin Quarry Aggregate and Asphalt Processing Plant. As residents and community members, we are concerned about the negative impact of increased production and emissions on our family and other residents in the area. We are opposed to this approval for several reasons. Health-Research well documents the health hazard of the particulates and gases found in fugitive dust from aggregate mining and emissions from asphalt processing plants. Pollutants increase the risk for heart attacks, heart failure, stroke, neurological diseases like dementia, lung disease, ectopic pregnancies, cancer, and type II diabetes. My family resides in West Mountain. We are exposed on a daily basis to the fugitive dust and asphalt byproducts. We protest any additional increase in the amount of exposure we have to these harmful substances. (See letter from Dr. Brian Moench from Utah Physicians for a Healthy Environment that is with this protest letter.) Water control of fugitive dust-Kilgore outlines in the NOI with the DAQ that they will control fugitive dust by hauling water to the site with water trucks. No minimum amount of water is specified for this dust control. This makes the enforcement of making sure adequate dust control measures are happening very difficult. The DAQ can do spot checks, but fugitive dust happens every day. Maricopa County in Arizona has the requirement of their mining operations to use a minimum of 30 gallons of water for dust control for every cubic yard mined. 66 cubic yards approximate to one ton of aggregate. If Kilgore mines the 800,000 tons per year as outlined in the changes to the NOI, they could mine up to 528,000 cubic yards. Using the 30 gallons of water for every cubic yard requirement as per Maricopa County to give an estimation for the water that Kilgore may need to feasibly control their fugitive dust, 15,480,000 gallons of water would be needed. Most water trucks carry 2,000-4,000 gallons of water. If 4,000 gallon tankers were used to truck water to the site, Kilgore would need 3,870 loads per year. Even if this computed figure was reduced by half due to less cubic yards mined or increased precipitation, the truck trips would still be 1,935. Really, how feasible is it for Kilgore to control all of the mining dust, roads, and stockpiles by hauling water onto the site? The current AO that requires Kilgore to use a sprinkling system should be kept in place. Only areas that reasonably cannot be controlled by sprinkler should be considered for dust suppressant by the water trucks. The sprinkling design system may need to be redesigned to control as much as the dust as is possible. The decision to just get rid of the sprinkling system is not the best BACT for the dust control. Utah Admin. Code R307-401-2. 74 Blasting plume-Changing the height of the plume of dust that is created when blasting from 70 feet to 50 feet from a modeling study does not accurately reflect what actually occurs on the Kilgore Benjamin site. The amended NOI is at 99.2% PTE of the NAAQS levels. This level is so close to exceeding the NAAQS that educated assumptions to the plume height should not be used. We ask that measurements be taken at the Benjamin site with blasting consistent to what will occur while mining. Utah Admin Code R307-401-8(1). Agricultural Impact-West Mountain has a unique microclimate that is ideal for growing fruit trees. A primary industry on West Mountain is orchard farming. West Mountain produces a wide variety of fruits. The area is one of the largest producers of cherry orchard produce for the country. Currently, many of the orchard farmers on West Mountain are experiencing a proliferation of dust mites due to the increased amount of fugitive dust in the area. Dust mites thrive on the fugitive dust that settles on orchard leaves and fruit. They can cause a loss of crops and trees. It is estimated that at least $4,000+ per acre is lost when a crop cannot be harvested. (As per presentation by local orchard grower to Utah County Commissioners.) We understand that mining operations are needed for the economic growth of an area, however, one industry cannot operate at the expense of another. The fugitive dust on West Mountain needs to decrease to protect the areas orchard industry. What happens on mining property, CANNOT spill over to adjoining properties. Road Safety-Mining operators on West Mountain are required to submit traffic plans for the number of trucks that will come to their pits and the routes the trucks will take to the freeway. These plans ae not binding. (Mining operators can run more truck trips than their submitted plan.) The traffic plans are submitted as a yearly average of one -way truck trips per day. With the submitted plans and an estimation of the pits that are not required to have a plan submitted, estimating on the low side, West Mountain may have a minimum of 400 one-way trips per day. Since this is a daily number for a yearly average, some days the truck traffic is less and other days it is much more. Taking the 400 daily trips X 365 days means that West Mountain can have 292,000 one-way truck trips on their roads in a years’ time. Because the truck trips are actually two trips-one to the pit and one back to destination-the number becomes doubled, 584,000. This is not an exaggeration. Residents have contacted local enforcement agencies, county commissioners, Utah Department of Public Safety, and Payson City due to road safety concerns. Accidents have occurred on many of the West Mountain streets that involve gravel trucks. There have been gravel trucks that have passed school buses with the lights flashing with several close calls of children being hit. Gravel trucks have tipped over on streets and into residents’ yards. Bikers have crashed due to the buckling on the roads caused by the large gravel trucks. Vehicles have had to pull off the road onto the shoulder to prevent crashes with trucks in their traffic lane. Adding more tonnage that Kilgore can mine, increasing the asphalt production amount and thus needing more supplies delivered to Kilgore, and controlling the fugitive dust by water trucks all increase the road traffic. The DAQ needs to take responsibility for what they are approving. It just does not involve the emissions in the air. Petroglyphs-West Mountain has over 90 documented rock art. The Kilgore Benjamin mining operation is close to many of these petroglyphs. The effects of air pollution on petroglyphs is currently being studied. Utah Code 9-8-404 outlines that before approving any undertaking an agency shall take into account the effect of the undertaking on any history property: and provide the state historic preservation officer with a written evaluation of the undertakings effect on any 75 historic property. The area should be protected as a historical site and not be an unprotected casualty of industry and business. Water and Soil Integrity-residents on West Mountain get their water supply for personal and agricultural use from wells and the Strawberry High Line canal. Increased emissions from asphalt production and aggregate mining increases the amount of fugitive dust and other by products that settle on the ground and into the canal. The byproducts on the ground can eventually seep into the soil and reach aquifers in the ground. Canal water is used to water livestock and to grow crops which are for human consumption. Residents need to have their water source protected. Enforcement-Our experience as a community is that it is very difficult to ensure existing requirements are closely being monitored by Utah divisions that regulate mining operations. Vague language and amendments to existing permits allow loopholes in the system that can be used to a mining operations advantage. Violations are not immediately rectified. In some cases, years can go by before something is corrected or brought back to the standard required in the permits. We appreciate the work and efforts of our state employees, but they often have too great of a workload to attend to all of the details. Having requirements and plans are only as good as they are implemented and held to accountability. The insufficiencies have negatively impacted our community. Cumulative effect-West Mountain has seven mining operations, evidence of at least three disturbed areas that are not being actively mined but no reclamation, the Payson City Landfill, and some mines that are in Genola and Santaquin areas that are in close proximity to West Mountain that are not included in the seven-mine total. Just looking at the seven mines-six of which are accessed along a seven-mile corridor on the west side of West Mountain-the total disturbed land acreage can approximate 600 acres. What is the impact to human and animal health to this much fugitive dust and hot asphalt emissions from these many sources in such a small area? What is the impact to the orchard industry and other agriculture crops/industry? Utah’s DAQ has failed the community by not considering the cumulative effect of all of these mining operations in such close proximity. (See totals for mining operations with this letter.) The assessment of cumulative impacts in EPA review of NEPA documents states “The combined, incremental effects of human activity, referred to as cumulative impacts, pose a serious threat to the environment. While they may be insignificant by themselves, cumulative impacts accumulate over time, from one or more sources, and can result in the degradation of important resources.” EPA 315-R-99- 002/May 1999. If Kilgore and the DAQ cannot give a definitive answer for the effect of their fugitive dust/asphalt emissions on the community as per single mining operator and as part of the group of numerous mines that all affect the same area, then they should have definitive accountability. This amendment to Kilgore’s AO with the DAQ should not be approved. The DAQ and Kilgore have the responsibility to establish a baseline of current air quality in the geographical area of West Mountain specifically, not at a monitor placed in Provo or Lindon. Well water and soil should also be tested to establish a baseline. Then, the DAQ and Kilgore should yearly test these items to prove that they are indeed not impacting and affecting the community negatively. We oppose the approval to amend Kilgore’s current AO with the DAQ. 76 (Part of submission) Email from Dr. Brian Moench indicating that Draper City letter is applicable to West Mountain. Attached is a letter we prepared regarding Geneva’s proposed expansion at the Point of the Mountain. Virtually all the issues we raised would be applicable to your situation as far as I can tell. You might take the position that no state agency should be permitting more gravel mining in the area unless the exposure of the nearby residents to the existing operation has been assessed, i.e. how does the exposure of residents in proximity to the gravel pit compare to exposure at other points along the Wasatch Front? And the amount of crystalline silica that the residents are currently exposed to should be determined. Those are reasonable requests, and could be the basis for asking for a delay in issuing the permit. We used that strategy in Lehi with some success that ended up with the Health Dept. monitoring the air quality for a year, delaying the project. A delay is always a partial victory. You can make the case that there is no urgency/emergency to issuing the permit. On the other hand, the medical research is well established and very definitive. If that permit increases or perpetuates more pollution for nearby residents then it is indisputable that their health will be negatively affected in multiple ways (as per the attached letter), even if the end result is that pollution remains below the state’s actionable thresholds. That raises the question; should a state agency be issuing a business permit that will harm all of the nearby residents? The answer to that should be no because that would be sacrificing the good of the entire community for the benefit of a single business. Regular monitoring of the pollution impact of the current operation for at least a year should be a mandatory first step in assessing whether a permit to expand should be granted. If the state is unwilling or unable to pay for that, then the business seeking the permit should be required to do so. Dr. Moench (Letter mentioned above) February 26, 2020 Draper City Council Draper City Planning Commission Utah Physicians for a Healthy Environment (UPHE) write to you regarding public health concerns related to Geneva’s request for an expansion of their mining operations at the Point of the Mountain. First, allow us to explain who we are. UPHE is the largest civic organization of health care professionals in the state of Utah, and one of the largest in the Western United States. Over 450 physicians are part of our 3,500 membership. Included in our membership are practicing clinicians in virtually every medical specialty, members of medical school faculties, researchers, administrators, two former members of the Utah Air Quality Board, a former chairman of that board, a former president of the Utah Medical Association, and officers of the medical associations of some of the state’s most prominent, well respected hospitals, insurers, and health organizations. During the last 13 years we have helped communities address air pollution and environmental contamination issues in multiple states throughout the country and in British Columbia, Australia, and the UK. UPHE “specializes” in knowing the full extent of available medical research on the health consequences of air pollution, and we update our data base of worldwide publications on a monthly basis. In short, UPHE is well qualified, likely more so than any other entity in the state of Utah, to offer expert assessments and opinions of air pollution issues and related public policy. Our major concern is the effect of sources of air pollution on public health. We realize that business is important but that it must take a ‘backseat’ to public health. The costs of air pollution far exceed any profits obtained by industry. Air pollution, including dust particulate matter, is significantly 77 associated with a list of adverse health outcomes almost as long as the list from smoking cigarettes. Air pollution affects the functioning of all major organs, increasing the risk of heart attacks, heart failure, strokes, neurologic diseases like dementia and impaired cognition, every type of lung disease, impaired fetal development and poor pregnancy outcomes, cancer, and metabolic diseases like type II diabetes. Air pollution accelerates the aging process, shortens the average person’s life span, and causes increased rates of disease related premature death. It even alters genetic function and damages chromosomes and can impair the health of future generations. Studies specific to people exposed to dust show some startling results. For example, residential populations chronically exposed to dust from such things as the desiccated Aral Sea, Owens Lake, and the Sahara Desert reveal a wide range of poor health outcomes, including shortened life expectancy, high rates of cancer, infectious diseases, respiratory and heart disease, reproductive pathologies, adverse pregnancy outcomes, anemia, birth defects, and infant mortality. 1 Even short term inhalation of the type of particles typical of gravel pit dust are associated with increased hospitalizations for heart disease. 2 Clean Air, Clean Energy, Clean Future 423 West 800 South, Suite A108, Salt Lake City UT 84101 § PHONE: (385) 707-3677 § UPHE.org Thousands of medical studies from throughout the world have established several tenets relevant to the dust pollution at the Point of the Mountain. 1. Despite the existence of federal clean air standards, there is no safe level of air pollution. Even at very low levels air pollution, including levels that are “allowed,” or “compliant with EPA standards,” are still causing significant harm to public health. Nonetheless, the Wasatch Front overall is still violating the EPA’s 24 hr PM2.5 standard. Any dust pollution from gravel mining will only add to existing background Wasatch Front levels and further increase the pollution and public health burden to Draper residents. 2. While dust pollution from mining and gravel pit operations certainly contains particles large enough to be captured by the upper respiratory tract and don’t represent as much of a health threat as smaller ones, it also contains significant amounts of smaller, more dangerous particles. Furthermore, those smaller particles stay suspended in the atmosphere longer, they disperse more widely, and they have the ability to penetrate homes more easily. 3. Toxicity and pubic health consequences are also related to whatever is attached to those particles, such as chemicals and metals. The soil at the Point of the Mountain has been analyzed and found to have higher than normal levels of heavy metals like arsenic, and about four times the typical amount of the radioactive metal, uranium. Particles in the diesel emissions from the heavy equipment used at the gravel and grading operations are significant sources of toxic chemicals like PAHs (polycyclic aromatic hydrocarbons). 4. Virtually everyone is harmed by air pollution whether or not they have symptoms, but there are substantial genetic and gender differences among individuals affecting their vulnerability to the health consequences. What is “clean enough” air for one person is not “clean enough” for all people. 5. Because of critical developmental windows, small children and babies in utero have much greater risk from pollution than adults. This is just one segment of the population for whom even brief exposure to pollution can have life long consequences. Because of greater physical activity, higher metabolic rates, and hand to mouth actions, young children will be more exposed than adults via both inhalation and ingestion. Exposure of pregnant women who live nearby will extend the public health consequences to more than one generation because of the damage that diesel exhaust and industrial pollution can do to chromosomes and fetal development. 3,4,5,6,7,8,9,10 If pollution levels are not safe for pregnant mothers, they cannot be considered safe for the community at large. The toxic dust generated will continue for years, but the health consequences will last much longer. 6. Residents of communities near gravel pits may have even greater exposure to the dust than gravel pit employees. The mining activity exceeds a 40-hour work week, disturbed raw land 78 surfaces are a perpetual source of dust, and the dust that lands on their yards, driveways, and inside their homes can be resuspended during a family’s daily activity, extending their exposure and magnifying the health risks. 7. Diesel emissions from the heavy equipment involved with the grading project will add significantly to the health hazard to nearby residents. Diesel exhaust is a proven carcinogen, revealed by recent research to be even more toxic than previously thought. A recent landmark study indicates that long term exposure to even low levels of diesel exhaust raises the risk of dying from lung cancer about 50% for residents who live near industrial operations, and about 300% for the workers.11,12 Clean Air, Clean Energy, Clean Future 423 West 800 South, Suite A108, Salt Lake City UT 84101 § PHONE: (385) 707-3677 § UPHE.org 8. Crystalline silica (CS) is an additional health threat unique to dust pollution. It causes a disease of the lungs known as silicosis. The amount of CS dust from the Point of the Mountain has not been assessed. But other studies in many other locations show wide variability in the percentage of respirable dust particles that are CS, anywhere from 1% to as much as 95%,13 depending on the type of mining operation and geographic location. The EPA has not set a National Ambient Air Quality Standard (NAAQS) for CS, however they do offer a “benchmark” of 3 ug/m3 (3 micrograms per cubic meter of air), but the EPA admitted they did not factor in people with existing lung disease, children, or pregnant mothers, and assumed that the public’s exposure would be less than in the workplace, something that is not likely true for Draper residents who live near the grading operations. Only a few states have established a “benchmark” level for ambient levels of CS and Utah is not one of them. Those state levels range from New York, the most strict at 0.06 ug/m3, to 3 ug/m3 in California, the same as the EPA. Studies from California recorded air samples from monitors downwind of gravel pit operations with concentrations of crystalline silica ranging from 9.4 to 62.4 ug/m3, many times greater than everyone one of those benchmarks, and orders of magnitude greater than the most strict of New York’s.14 Without any data specific to Utah or the Point of the Mountain, the best that can be said is that no one knows how much additional health risk there is from CS in the dust pollution of the gravel operation. However, if conditions are similar to those in California, the CS in the atmosphere could indeed be much greater than what any government agency considers acceptable. The age of silica particles matters. Crystalline silica is particularly high in industrial settings, like mining operations that expose freshly fractured solid rock (e.g., crushing, grinding, blasting, cutting),15 which is precisely the nature of the gravel pit operations at the Point of the Mountain. By virtue of their close proximity, nearby residents are subjected to the same higher risk, industrial type of silica as gravel pit employees.16 While chronic silicosis is usually thought of as an occupational disease, significant rates of non-occupational silicosis have been documented in residents exposed to frequent dust storms.16 In short, Draper city officials should consider their first priority to be the protection of the health of residents of Salt Lake and Utah Counties, especially Draper residents. The decision of whether to appease Geneva should rest solely on what is best the community at large, not what is best for Geneva’s profitability. Signed by: Brian Moench M.D. UPHE President Richard Kanner M.D. UPHE Board Member Kirtly Jones M.D. UPHE Board Member John Macfarlane M.D. Board Member Courtney Henley M.D. Jonny Vasic Executive Director Clean Air, Clean Energy, Clean Future 423 West 800 South, Suite A108, Salt Lake City UT 84101 § PHONE: (385) 707-3677 § UPHE.org References 1. Dr. Oral A. Ataniyazova, M.Sc., the Karakalpak Center for Reproductive Health. Health and Ecological Consequences of the Aral Sea Crisis and Environment, Uzbekistan. Prepared for the 3rd World Water Forum Regional Cooperation in Shared Water Resources in Central Asia. Kyoto, March 18, 2003 2. Powell H, Krall JR, Wang Y, Bell ML, Peng RD. 2015. Amb ient coarse particulate matter and hospital admissions in the Medicare Cohort Air Pollution Study, 1999–2010. 79 Environ Health Perspect 123:1152– 1158; http://dx.doi.org/10.1289/ ehp.1408720 3. Topinka J, Rossner P Jr, Milcova A, Schmuczerova J, Svecova V, Sram RJ. DNA Adducts and Oxidative DNA Damage Induced by Organic Extracts From PM2.5 in an Acellular Assay. Toxicol Lett. 2011 Feb 14. [Epub ahead of print] 4. Baccarelli A, Wright RO, Bollati V, Tarantini L, Litonjua AA, Suh HH, Zanobetti A, Sparrow D, Vokonas PS, Schwartz J. Rapid DNA methylation changes after exposure to traffic particles. Am J Respir Crit Care Med. 2009 Apr 1;179(7):523-4. 5. Manikkam M, Guerrero-Bosagna C, Tracey R, Haque MM, Skinner MK (2012) Transgenerational Actions of Environmental Compounds on Reproductive Disease and Identification of Epigenetic Biomarkers of Ancestral Exposures. PLoS ONE 7(2): e31901. doi:10.1371/journal.pone.0031901 6. Herbstman JB, Tang D, Zhu D, Qu L, Sjödin A, Li Z, et al. 2012. Prenatal Ex- posure to Polycyclic Aromatic Hydrocarbons, Benzo[a]pyrene–DNA Adducts, and Genomic DNA Methylation in Cord Blood. Environ Health Perspect 120:733-738. http://dx.doi.org/ 10.1289/ehp.1104056 7. Tillett T Potential Mechanism for PM10 Effects on Birth Outcomes: In Utero Exposure Linked to Mitochondrial DNA Damage. Environ Health Perspect 120:a363- a363. http://dx.doi.org/10.1289/ehp.120-a363b 8. Janssen BG, Godderis L, Pieters N, Poels K, Kici Ski M, Cuypers A, Fierens F, Penders J, Plusquin M, Gyselaers W, Nawrot TS. Placental DNA hypomethylation in association with particulate air pollution in early life. Part Fibre Toxicol. 2013 Jun 7;10(1):22. [Epub ahead of print] 9. Weldy CS, Y Liu, YC Chang, IO Medvedev, JR Fox, TV Larson, WM Chien, MT Chin. In utero and early life exposure to diesel exhaust air pollution increases adult susceptibility to heart failure in mice. Particle and Fibre Toxicology. 2013. http://bit.ly/ 18znRIR 10. Bijnens E, Zeegers MP, Gielen M, Kicinski M, Hageman GJ, Pachen D, Derom C, Vlietinck R, Nawrot TS. Lower placental telomere length may be attributed to maternal residential traffic exposure; a twin study. Environ Int. 2015 Mar 7;79:1-7. doi: 10.1016/j.envint.2015.02.008. [Epub ahead of print] 11. Silverman DT, Samanic CM, Lubin JH, et al. The diesel exhaust in miners study: a nested casecontrol study of lung cancer and diesel exhaust. J Natl Cancer Inst. March 2, 2012. doi:10.1093/jnci/djs034. 12. Attfield MD, Schlieff PL, Lubin JH, et al. The diesel exhaust in miners study: a cohort mortality study with emphasis on lung cancer. J Natl Cancer Inst. March 2, 2012. doi:10.1093/jnci/djs035. Clean Air, Clean Energy, Clean Future 423 West 800 South, Suite A108, Salt Lake City UT 84101 § PHONE: (385) 707 - 3677 § UPHE.org 13. Environment Canada. 2013. Screening Assessment for the Challenge: Quartz, Chemical Abstracts Service Registry Number 14808-60-7; Cristobalite, Chemical Abstracts Service Registry Number 14464- 46-1. Available: http://www.ec.gc.ca/ese- ees/default.asp?lang=En&n=1EB4F4EF-1 14. https://dnr.wi.gov/files/pdf/pubs/am/am407.pdf 15. Vallyathan, V., et al., “Generation of Free Radicals from Freshly Fractured Silica Dust,” American Review of Respiratory Disease, vol. 138, 1988, p. 1213. 16. Bhagia, L J. Non-occupational exposure to silica dust. Indian J Occup Environ Med. 2012 Sep-Dec; 16(3): 95–100. doi: 10.4103/0019-5278.111744 DAQ Response to Comment G5: Please see DAQ Response to Comment G2 for the limitations on the DAQ’s regulatory authority. The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit as a result of this comment. 80 Comment G6 - Received January 29, 2023 Hello, this email is to express my disapproval of the proposed Kilgore Expansion. One of the best things about South Utah valley is the clean air. This expansion proposes increasing pollution output by 20%, which is not insignificant. We need to keep our air clean for both ourselves and future generations. DAQ Response to Comment G6: The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit as a result of this comment. Comment G7 - Received January 29, 2023 We have lived in West Mountain for 31 year. It is, or was a quite farming community. We currently have 3 gravel pits running in West Mountain and would definitely NOT like anymore OR any more increase production approved for any of them. We have large diesel trucks going on roads that were not built for that kind of traffic, which have put the people that live here in at risk. By approaching more products it will increase that risk. We expect our county officials to help protect our way of life. West Mountain is not an expendable place to be plundered for its resources. DAQ Response to Comment G7: Please see DAQ Response to Comment G2 for the limitations on the DAQ’s regulatory authority. The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit as a result of this comment. Comment G8 - Received January 29, 2023 Division of Air Quality There are currently three “Gravel Pits” operating in and around our community. We have been a quiet residential and farming community of citizens who live here for the peace and quiet West Mountain has offered. Now our roads are dirty, noisy and congested with large noisy trucks driving on roads woefully unfit for them! Turns are too sharp and lanes too narrow! There will be serious accidents eventually! We are not a mining community but suffer from the noise and pollution of one! Mining operations and large diesel trucks contrast sharply from the lovely homes and rural atmosphere West Mountain provides. Near the Kilgore site there are priceless artifacts from native Americans who lived by the shores of Utah Lake! Expansion of mining and particulates threaten this irreplaceable history. There are many less attractive sites where a “Gravel Pit” can thrive. Small rural communities give soul to our County gravel pits do not! Are we so hungry for tax dollars to risk the residents of this rare community? Please choose wisely. 81 DAQ Response to Comment G8: The DAQ mission includes “safeguarding and improving Utah’s air through balanced regulation.” Current Utah law, including application and permitting requirements, applies to the new installations and modifications to existing installations, such as the Kilgore Benjamin Pit. Kilgore has complied with the requirements of the application process and its proposed permit is meeting the regulatory requirements. Please see DAQ Response to Comment G4 regarding conditions added as a result of modeling. Please see DAQ Response to Comment G2 regarding the limits of DAQ’s authority. The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit as a result of this comment. Comment G9 - Received January 29, 2023 Department of Air Quality, This email is referencing DAQE-INI58520002-22. I live on 7300 South in Benjamin, the main road for the trucks going to and coming from Kilgore’s pit. DAQ has the responsibility to protect human health and safety, the environment, and the interests of the state and citizens. We also have 80 acres of property within a mile north of Kilgore’s pit and make a lot of trips daily to check and feed our animals and to irrigate the pasture. We spend a lot of time and have the opportunity to observe Kilgore’s pit daily. Only one time since Kilgore’s took over the pit have I seen them using a water truck to wet down the roads to help minimize the fugitive dust they create daily! I have never observed them using sprinklers on the mined aggregate to minimize fugitive dust. No trees or wind breaks have ever been established. The fumes and emissions from their asphalt plant are unbearable, when they are hauling asphalt we won’t let our grandchildren be outside our house because of the smell. Kilgore has not been in compliance with their NOI and not a single state or county agency will enforce their established protocol. Allowing Kilgore’s expansion does not protect the citizens of our community, their fugitive dust is out of control, it affects growth of our pasture and the health of our animals. In addition, there have already been several truck crashes in our community and it is only a matter of time until a Kilgore truck kills someone. Our infrastructure was not built to handle all their trucks going to and from their gravel and asphalt plant. We can NOT tolerate 1,050,000 million tons of their products to be moved yearly on our current infrastructure. The only option is to NOT allow Kilgore to expand their current operation, and make them start to reclaim the mess they have already made of the mountain. There is no way a 1.5:1 four hundred foot high wall is going to be reclaimed to make the mountain look natural and aesthetic. Utah County requires a 2:1 slope maximum. It is time to do what is morally and ethically right and not allow Kilgore to continue to “run over us, our safety and our heritage!” Below are some of my concerns. ∙Safety- o Increased truck traffic (exceeding approved quota); trucks not obeying traffic laws and regulations; insufficient road infrastructure. o Non-compliant with numerous current regulations (e.g., no fire safety plan). 82 ∙Health- o Air contamination with silica dust produced from the pit and the carcinogens emitted by the asphalt plant. No fugitive dust control measures at all, they have not even used water trucks or sprinklers to reduce the fugitive dust as agreed in their original NOI. o Inadequate and no containment berms and insufficient barriers under recycled asphalt stored on site, as agreed in their original NOI. o Numerous imminent potential sources of pollutants and contaminants threatening surface and ground water resources with their runoff going directly into the Hyline canal. No retention berms or ponds as agreed in their original NOI. o 24-hour noise pollution (blasting, heavy equipment backup alarms, crushing, and truck Jake brakes). ∙Aesthetics o Having a 30 foot barrier between the cultural artifacts and the mine is not enough of a buffer zone, especially when it is mined around it. o Reclamation needs to happen before more area is disturbed; we already have too much dust. o 1.5:1 slope is too steep for reclamation to the original state of the mountain. Kilgore needs to comply with all the aspects of their original NOI before they are given approval to expand and operate under another NOI. To date they have been completely non-compliant, it is evident by looking at the attached documents. Kilgore has admitted to being out of compliance at the Utah County Commission meeting, but no one to this point has made them comply. It is always someone else’s responsibility to enforce their fraudulent claims in their NOI, it is time to bring Kilgore into compliance and not allow them to expand. Attached are some pictures to validate my claims. Sincerely, Nyle Russell DAQ Response to Comment G9: Please see DAQ Response to Comment G2 regarding DAQ’s authority and the role of the compliance section. The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit as a result of this comment. 83 Comment G10 – Received January 26, 2023 (At public hearing) 84 85 86 87 88 89 90 91 92 93 94 95 96 DAQ Response to Comment G10: Please see DAQ Responses to Comments P1 through P4, M1 through M10, C1, and G2 through G4. The commenter does not specify how the ITA does not meet state and federal rules. No changes were made to the permit as a result of this comment. DAQE-IN158520002-22 November 29, 2022 Lee Ware Kilgore Companies, LLC 7057 West 2100 South Salt Lake City, UT 84128 lee.ware@kilgorecompanies.com Dear Mr. Ware: Re: Intent to Approve: Minor Modification to Approval Order DAQE-AN158520001-18 to Increase Production Project Number: N158520002 The attached document is the Intent to Approve (ITA) for the above-referenced project. The ITA is subject to public review. Any comments received shall be considered before an Approval Order (AO) is issued. The Division of Air Quality is authorized to charge a fee for reimbursement of the actual costs incurred in the issuance of an AO. An invoice will follow upon issuance of the final AO. Future correspondence on this ITA should include the engineer's name, Christine Bodell, as well as the DAQE number as shown on the upper right-hand corner of this letter. Christine Bodell, can be reached at (385) 290-2690 or cbodell@utah.gov, if you have any questions. Sincerely, {{$s }} Alan D. Humpherys, Manager New Source Review Section ADH:CB:jg cc: Utah County Health Department Dan Fagnant, EPA Region 8 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 536-4414 www.deq.utah.gov Printed on 100% recycled paper State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director STATE OF UTAH Department of Environmental Quality Division of Air Quality INTENT TO APPROVE DAQE-IN158520002-22 Minor Modification to Approval Order DAQE-AN158520001-18 to Increase Production Prepared By Christine Bodell, Engineer (385) 290-2690 cbodell@utah.gov Issued to Kilgore Contracting, LLC - Benjamin Aggregate & Asphalt Plant Issued On November 29, 2022 {{$s }} New Source Review Section Manager Alan D. Humpherys {{#s=Sig_es_:signer1:signature}} TABLE OF CONTENTS TITLE/SIGNATURE PAGE ....................................................................................................... 1 GENERAL INFORMATION ...................................................................................................... 3 CONTACT/LOCATION INFORMATION ............................................................................... 3 SOURCE INFORMATION ........................................................................................................ 3 General Description ................................................................................................................ 3 NSR Classification .................................................................................................................. 3 Source Classification .............................................................................................................. 3 Applicable Federal Standards ................................................................................................. 3 Project Description.................................................................................................................. 4 SUMMARY OF EMISSIONS .................................................................................................... 4 PUBLIC NOTICE STATEMENT............................................................................................... 4 SECTION I: GENERAL PROVISIONS .................................................................................... 5 SECTION II: PERMITTED EQUIPMENT .............................................................................. 6 SECTION II: SPECIAL PROVISIONS ..................................................................................... 7 PERMIT HISTORY ................................................................................................................... 15 ACRONYMS ............................................................................................................................... 16 DAQE-IN158520002-22 Page 3 GENERAL INFORMATION CONTACT/LOCATION INFORMATION Owner Name Source Name Kilgore Contracting, LLC Kilgore Contracting, LLC - Benjamin Aggregate & Asphalt Plant Mailing Address Physical Address 7057 West 2100 South 7200 South 5600 West Salt Lake City, UT 84128 Benjamin, UT 84660 Source Contact UTM Coordinates Name Lee Ware 431,360 m Easting Phone (801) 831-7402 4,439,030 m Northing Email lee.ware@kilgorecompanies.com Datum NAD83 UTM Zone 12 SIC code 1442 (Construction Sand & Gravel) SOURCE INFORMATION General Description Kilgore Contracting, LLC (Kilgore) operates the Benjamin Pit asphalt and aggregate processing plant in Utah County. Standard aggregate and hot mix asphalt (HMA) equipment such as crushers, screens, stockpiles, hoppers, conveyors, silos, and storage tanks are present on site. The aggregate facility utilizes line power to power on site crushers and screens. Aggregate materials are fed into crushers and screens after on-site drilling and blasting. Aggregates cycle through the crushers and screens to achieve appropriate sizing and are stored on location before being trucked off site or to the asphalt plant. The asphalt plant mixes aggregate, asphalt oil, lime, and fly ash to produce hot mix asphalt. NSR Classification Minor Modification at Minor Source Source Classification Located in Southern Wasatch Front O3 NAA, Provo UT PM2.5 NAA Utah County Airs Source Size: SM Applicable Federal Standards NSPS (Part 60), A: General Provisions NSPS (Part 60), I: Standards of Performance for Hot Mix Asphalt Facilities NSPS (Part 60), OOO: Standards of Performance for Nonmetallic Mineral Processing Plants DAQE-IN158520002-22 Page 4 Project Description Kilgore has requested modification to the Benjamin Pit AO. The source has proposed to increase processed aggregate production by 200,000 tpy for a total of 800,000 tpy and to increase HMA production by 40,000 tpy, for a total of 250,000 tpy. One (1) 40-ton fly ash silo will be added. Condition II.B.3.h was updated to reflect the updated control mechanism of water cannon and/or water truck spray to storage piles. Due to the varying heights and locations of the storage piles, spray bars were found to be technically limiting. Water cannon and/or water truck spray were found to be equally as efficient for water-based controls. No other equipment will be added or modified as a result of this change. SUMMARY OF EMISSIONS The emissions listed below are an estimate of the total potential emissions from the source. Some rounding of emissions is possible. Criteria Pollutant Change (TPY) Total (TPY) CO2 Equivalent -2199.53 3041.60 Carbon Monoxide 2.93 19.22 Nitrogen Oxides -1.97 4.44 Particulate Matter - PM10 5.99 18.79 Particulate Matter - PM2.5 2.29 7.72 Sulfur Dioxide 2.30 7.25 Volatile Organic Compounds 1.04 6.21 Hazardous Air Pollutant Change (lbs/yr) Total (lbs/yr) Acetaldehyde (CAS #75070) 53 326 Formaldehyde (CAS #50000) 126 796 Generic HAPs (CAS #GHAPS) 33 440 Hexane (CAS #110543) 36 234 Naphthalene (CAS #91203) 26 165 Toluene (CAS #108883) 112 730 Change (TPY) Total (TPY) Total HAPs 0.20 1.35 PUBLIC NOTICE STATEMENT The NOI for the above-referenced project has been evaluated and has been found to be consistent with the requirements of UAC R307. Air pollution producing sources and/or their air control facilities may not be constructed, installed, established, or modified prior to the issuance of an AO by the Director. A 30-day public comment period will be held in accordance with UAC R307-401-7. A notification of the intent to approve will be published in The Daily Herald on November 30, 2022. During the public comment period the proposal and the evaluation of its impact on air quality will be available for the public to review and provide comment. If anyone so requests a public hearing within 15 days of publication, it will be held in accordance with UAC R307-401-7. The hearing will be held as close as practicable to the location of the source. Any comments received during the public comment period and the hearing will be evaluated. The proposed conditions of the AO may be changed as a result of the comments received. DAQE-IN158520002-22 Page 5 SECTION I: GENERAL PROVISIONS The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. I.1 All definitions, terms, abbreviations, and references used in this AO conform to those used in the UAC R307 and 40 CFR. Unless noted otherwise, references cited in these AO conditions refer to those rules. [R307-101] I.2 The limits set forth in this AO shall not be exceeded without prior approval. [R307-401] I.3 Modifications to the equipment or processes approved by this AO that could affect the emissions covered by this AO must be reviewed and approved. [R307-401-1] I.4 All records referenced in this AO or in other applicable rules, which are required to be kept by the owner/operator, shall be made available to the Director or Director's representative upon request, and the records shall include the two-year period prior to the date of the request. Unless otherwise specified in this AO or in other applicable state and federal rules, records shall be kept for a minimum of two (2) years. [R307-401-8] I.5 At all times, including periods of startup, shutdown, and malfunction, owners and operators shall, to the extent practicable, maintain and operate any equipment approved under this AO, including associated air pollution control equipment, in a manner consistent with good air pollution control practice for minimizing emissions. Determination of whether acceptable operating and maintenance procedures are being used will be based on information available to the Director which may include, but is not limited to, monitoring results, opacity observations, review of operating and maintenance procedures, and inspection of the source. All maintenance performed on equipment authorized by this AO shall be recorded. [R307-401-4] I.6 The owner/operator shall comply with UAC R307-107. General Requirements: Breakdowns. [R307-107] I.7 The owner/operator shall comply with UAC R307-150 Series. Emission Inventories. [R307-150] I.8 The owner/operator shall submit documentation of the status of construction or modification to the Director within 18 months from the date of this AO. This AO may become invalid if construction is not commenced within 18 months from the date of this AO or if construction is discontinued for 18 months or more. To ensure proper credit when notifying the Director, send the documentation to the Director, attn.: NSR Section. [R307-401-18] DAQE-IN158520002-22 Page 6 SECTION II: PERMITTED EQUIPMENT The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. II.A THE APPROVED EQUIPMENT II.A.1 Benjamin Aggregate & Asphalt Plant II.A.2 Aggregate Plant Crushing, screening, hauling, conveying, and storing II.A.3 One (1) Jaw Crusher Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.4 One (1) Cone Crusher Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.5 One (1) Vertical Shaft Impactor Crusher Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.6 Three (3) Triple Deck Screens Size: 8' x 20' Capacity: 400 TPH Each NSPS Applicability: Subpart OOO II.A.7 Various Aggregate Conveyors NSPS Applicability: Subpart OOO II.A.8 Miscellaneous Equipment Feeders, conveyors, stackers, wash screws, wash screes, etc. II.A.9 Asphalt Plant Production of Hot Mix Asphalt II.A.10 One (1) Asphalt Mix Drum Drum Rated Capacity: 400 TPH Hot Oil Burner Rating: 165 MMBtu/hr Control: Baghouse NSPS Applicability: Subpart I II.A.11 One (1) Scalping Screen Size: 6' x 20' Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.12 One (1) Hot Oil Heater Rating: < 0.25 MMBtu/hr Control: Low NOx Burner II.A.13 One (1) Waste Oil Storage Tank Maximum Capacity: 15,000 gallons DAQE-IN158520002-22 Page 7 II.A.14 Three (3) Asphalt Oil Storage Tanks Maximum Capacity: 30,000 gallons Each NSPS Applicability: Subpart I II.A.15 One (1) Lime Silo Maximum Capacity: 40 Tons Control: Baghouse NSPS Applicability: Subpart I II.A.16 Three (3) Asphalt Storage Silos Maximum Capacity: 300 Tons Each Control: Baghouse NSPS Applicability: Subpart I II.A.17 One (1) Fly Ash Silo (New) Maximum Capacity: 40 Tons Control: Baghouse NSPS Applicability: Subpart I II.A.18 Five (5) Diesel Storage Tanks Maximum Capacity: 6,000 Gallons Total SECTION II: SPECIAL PROVISIONS The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. II.B REQUIREMENTS AND LIMITATIONS II.B.1 Site Wide Requirements II.B.1.a Unless otherwise specified in this AO, the owner/operator shall not allow visible emissions from any source on site to exceed 20% opacity. [R307-201-3, R307-401-8] II.B.1.b Unless otherwise specified in this AO, opacity observations of visible emissions from stationary sources shall be conducted according to 40 CFR 60, Appendix A, Method 9. [R307-201-3] II.B.2 Aggregate Pit Requirements II.B.2.a The owner/operator shall not produce more than 800,000 tons of processed aggregate material per rolling 12-month period. [R307-401-8] II.B.2.a.1 The owner/operator shall: A. Determine production by scale house records or vendor receipts. B. Record production on a daily basis C. Use the production data to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months D. Keep the production records for all periods the plant is in operation. [R307-401-8] DAQE-IN158520002-22 Page 8 II.B.2.b Visible emissions from the following emission points shall not exceed the following values: A. Crushers - 12% opacity B. Screens - 7% opacity C. All Conveyor Transfer Points - 7% opacity. [R307-312, R307-401-8] II.B.2.c The owner/operator shall install water sprays on all crushers, all screens, all conveyor transfer points, and all conveyor drop points to control emissions. Sprays shall operate as required to ensure the opacity limits in this AO are not exceeded. [R307-401-8] II.B.2.d The owner/operator shall perform monthly periodic inspections to check that water is flowing to discharge spray nozzles associated with each crusher, screen, and conveyor. If the owner/operator finds that water is not flowing properly during an inspection of the water spray nozzles, the owner/operator shall initiate corrective action within 24 hours and complete corrective action as expediently as practical. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.d.1 Records of the water sprays inspections shall be kept and maintained in a logbook for all periods when the plant is in operation. The records shall include the following items: A. Date the inspections were made B. Any corrective actions taken C. Control mechanism used if sprays are not operating. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.e The owner/operator shall conduct an initial performance test for all crushers, screens, and conveyor transfer points on site within 60 days after achieving maximum production rate but not later than 180 days after initial startup. Performance tests shall meet the limitations specified in Table 3 of Subpart OOO. Records of initial performance tests shall be kept and maintained on site for the lifetime of the equipment. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.e.1 Initial performance tests for fugitive emission limits shall be conducted according to 40 CFR 60.675(c). The owner/operator may use methods and procedures specified in 40 CFR 60.675(e) an alternative. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.e.2 The owner/operator shall submit written reports of the results of all performance tests conducted to demonstrate compliance with 40 CFR 60.672 to the Director, attn.: Compliance Section. The submission shall be postmarked no later than 180 days from the date of this AO or no later than 180 days from equipment start-up, whichever is later. [40 CFR 60 Subpart OOO, R307-401-8] II.B.3 All Haul Roads and Fugitive Dust Sources Requirements II.B.3.a The owner/ operator shall not exceed the following: A. 18.00 acres of storage pile and disturbed ground combined B. 9,980 feet (1.89 miles) of unpaved haul roads. [R307-401-8] DAQE-IN158520002-22 Page 9 II.B.3.a.1 Compliance shall be determined through GPS measurements or aerial photographs. Reclaimed areas such as those with emerged vegetation or hydro-seeded do not contribute to the acreage totals. [R307-401-8] II.B.3.b The owner/operator shall ensure the entry haul road is paved for no less than 3,000 feet (0.57 miles) in length. [R307-401-8] II.B.3.b.1 The paved road length shall be determined through source records or GPS measurements. [R307-401-8] II.B.3.c The owner/operator shall not allow visible emissions to exceed the following: A. Haul roads - 20% opacity B. Storage Piles - 10% opacity C. All other fugitive dust sources - 20% opacity D. All sources at the property boundary - 10% opacity. [R307-309-5] II.B.3.d Visible emission determinations for fugitive dust from haul roads and operational areas shall use procedures similar to Method 9. The normal requirement for observations to be made at 15- second intervals over a six-minute period, however, shall not apply. Visible emissions shall be measured at the densest point of the plume but at a point not less than one-half vehicle length behind the vehicle and not less than one-half the height of the vehicle. [R307-309-5] II.B.3.e The owner/operator shall comply with a fugitive dust control plan (FDCP) consistent with R307- 309-6. [R307-309-6, R307-401-8] II.B.3.f The owner/operator shall comply with all applicable requirements of R307-309 for Fugitive Emission and Fugitive Dust sources on site. [R307-309, R307-401-8] II.B.3.g An operational sweeper and water truck shall be made available during each operating day. The owner/operator shall vacuum sweep and flush with water all the paved haul roads on site to maintain opacity limits listed in this AO. If the temperature is below freezing, the owner/operator shall continue to vacuum sweep the road but may stop flushing the paved haul roads with water. Flushing the paved haul road with water shall resume when the temperature is above freezing. If the haul roads are covered with snow or ice, the owner/operator may stop vacuum sweeping the paved haul roads. Vacuum sweeping the paved haul roads shall resume when the haul roads are cleared from snow and ice. [R307-401-8] II.B.3.g.1 Records of vacuum sweeping and water application shall be kept for all periods when the plant is in operation. The records shall include the following items: A. Date and time treatments were made B. Number of treatments made and quantity of water applied C. Rainfall amount received, if any D. Records of temperature, if the temperature is below freezing E. Records shall note if the paved haul roads are covered with snow or ice. [R307-401-8] DAQE-IN158520002-22 Page 10 II.B.3.h The owner/operator shall cover all unpaved haul roads and wheeled-vehicle operational areas with road base material, and an operational water truck shall be made available during each operating day. The owner/operator shall use chemical suppressant and water application to maintain opacity limits listed in this AO. If the temperature is below freezing, the owner/operator may stop applying chemical suppressant and water to the unpaved haul roads and wheeled-vehicle operational areas. The owner/operator shall resume applying chemical suppressant and water to the unpaved haul roads and wheeled-vehicle operational areas when the temperature is above freezing. [R307-401-8] II.B.3.h.1 Records of chemical suppressant and water application shall be kept for all periods when the plant is in operation. The records shall include the following items: A. Date and time treatments were made B. Number of treatments made, quantity of water applied, and chemical dilution ratio used C. Rainfall amount received, if any D. Records of temperature, if the temperature is below freezing. [R307-401-8] II.B.3.i The owner/operator shall control particulate emissions from storage piles using water trucks and/or water cannons. The water trucks and/or water cannons shall operate as required to ensure the opacity limits in this AO are not exceeded. [R307-401-8] II.B.3.i.1 Records of water application to the storage piles kept for all periods when the plant is in operation. The records shall include the following items: A. The date, time and location of applications B. The volume of water applied. [R307-401-8] II.B.3.j The owner/operator shall not exceed 1,800 bulldozing hours per rolling 12-month period. [R307-401-8] II.B.3.j.1 The owner/operator shall: A. Determine hours of operation with a supervisor monitoring and maintaining an operations log. The hours of operation of each bulldozer shall be added together to determine the total hours B. Record hours of operation each day C. Use the hours of operation to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months D. Keep hours of operation records for all periods the plant is in operation. [R307-401-8] II.B.3.k The owner/operator shall not conduct blasting operations before 10:00 am or after 2:00 pm each day. [R307-401-8] DAQE-IN158520002-22 Page 11 II.B.3.k.1 The owner/operator shall keep and maintain the following records of operation for all periods of blasting: A. Time blasting operations begin each day B. Time blasting operations end each day. [R307-401-8] II.B.3.l The owner/operator shall not exceed the following blasting limits: A. 30 blasts per rolling 12-month period B. 126 tons of ANFO used per rolling 12-month period C. An area of 6,262 square feet blasted per blast. [R307-401-8] II.B.3.l.1 Records of blasts shall be kept for all periods when the plant is in operation. The records shall include the following: A. Date of each blast B. Area of each blast C. Tons of ANFO used for each blast. The owner/operators shall use the records to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months. [R307-401-8] II.B.3.m The owner/operator shall not conduct drilling operations before 7:00 am or after 5:00 pm each day. [R307-401-8] II.B.3.m.1 The owner/operator shall keep and maintain the following records of operation for all periods of drilling: A. Time drilling operations begin each day B. Time drilling operations end each day. [R307-401-8] II.B.3.m.2 The owner/operator shall control emissions from drilling operations with the use of drill mounted water sprays (water injection) and drill shrouds. [R307-401-8] II.B.4 Hot Mix Asphalt Plant Operating Requirements II.B.4.a The owner/operator shall not produce more than 250,000 tons of hot mix asphalt per rolling 12- month period. [R307-401-8] DAQE-IN158520002-22 Page 12 II.B.4.a.1 The owner/operator shall: A. Determine production by the belt scale on the initial feeder, vendor receipts, or other methods approved by the Director. B. Record production on a daily basis C. Use the production data to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months D. Keep the production records for all periods the plant is in operation. [R307-401-8] II.B.4.b The owner/operator shall not operate the hot mix asphalt plant during the months of January and February. [R307-401-8] II.B.4.b.1 Records of operation shall be kept for all periods when the plant is in operation. Supervisor monitoring and maintaining of an operations log shall determine days of operation. [R307-312, R307-401-8] II.B.4.c The owner/operator shall use natural gas, propane, fuel oil, or on-specification used oil as defined in R315-15, or any combination thereof as fuel in the hot mix asphalt plant. [R307-401-8] II.B.4.d The sulfur content of any fuel oil burned in the hot mix asphalt plant shall not exceed 15 ppm by weight. [R307-401-8] II.B.4.d.1 The sulfur content shall be determined by ASTM Method D2880-71, D4294-89, or approved equivalent. Certification of fuel oil shall be either by the owner/operator's own testing or by test reports from the fuel oil marketer. [R307-203-1, R307-401-8] II.B.4.d.2 The owner/operator shall keep and maintain records of the test certification of sulfur content in fuel oil. Records of the test certifications shall be kept for all periods when the plant is in operation. [R307-203-1, R307-401-8] II.B.4.e The owner/operator shall comply with the limitations and compliance requirements under R307- 312-5 for burning a fuel other than natural gas or liquefied petroleum gas (LPG). [R307-312] II.B.4.f The owner/operator shall maintain fuel records for the months of November and December. [R307-401-8] II.B.5 Baghouse Requirements II.B.5.a The owner/operator shall equip each lime, fly ash, and asphalt storage silo with a baghouse to control particulate emissions generated during filling and emptying of the silos. Each baghouse shall be used during all periods of loading and unloading. [R307-401-8] II.B.5.b The owner/operator shall not allow visible emissions from any baghouse to exceed 10% opacity. [R307-401-8] II.B.5.c The owner/operator shall install a manometer or magnehelic pressure gauge to measure the differential pressure across each baghouse. [R307-401-8] II.B.5.c.1 Each pressure gauge shall be located such that an inspector/operator can safely read the indicator at any time. [R307-401-8] DAQE-IN158520002-22 Page 13 II.B.5.c.2 Each pressure gauge shall measure the pressure drop in 1-inch water column increments or less. [R307-401-8] II.B.5.d During operation of the asphalt drum mixer baghouse, the owner/operator shall maintain the static pressure drop across the baghouse between 2.0 and 6.0 inches of water column. During operation of the storage silo baghouses, the owner/operator shall maintain the static pressure drop within the range recommended by the manufacturer for normal operations. [R307-401-8] II.B.5.d.1 The owner/operator shall record the pressure drop at least once per operating day while each baghouse is operating. [R307-401-8] II.B.5.d.2 The owner/operator shall maintain the following records of the pressure drop readings: A. Unit identification; B. Manufacturer recommended static pressure drop for the unit (if applicable); C. Date of reading; D. Daily static pressure drop readings. [R307-401-8] II.B.5.e At least once every 12 months, the owner/operator shall calibrate the pressure gauges in accordance with the manufacturer's instructions or replace the gauges. [R307-401-8] II.B.5.e.1 The owner/operator shall maintain records of the pressure gauge calibrations and replacements. [R307-401-8] II.B.5.f The owner/operator shall install a baghouse on each lime, fly ash, and asphalt storage silo with a control efficiency of no less than 98%. [R307-401-8] II.B.5.f.1 To demonstrate compliance with the above condition, the owner/operator shall maintain records of the manufacturer's control efficiency guarantee for the installed baghouse. [R307-401-8] II.B.5.g The owner/operator shall use a baghouse to control process streams from the asphalt plant drum. The baghouse shall be sized to handle at least 69,000 ACFM. All exhaust air from the drum shall be routed through the baghouse before being vented to the atmosphere. [R307-401-8] II.B.5.h The owner/operator shall not emit more than the following rates and concentrations from the Asphalt Plant Baghouse: Pollutant grains/dscf Filterable PM10 0.024 Filterable PM2.5 0.024. [R307-801-8] DAQE-IN158520002-22 Page 14 II.B.5.h.1 Compliance Demonstration To demonstrate compliance with the emission limitations above, the owner/operator shall perform stack testing on the emissions unit according to the stack testing conditions contained in this AO. The owner/operator shall test for condensable PM; however, the condensable particulate emissions shall not be used for compliance demonstration, but shall be used for inventory purposes. [R307-165-2, R307-401-8] II.B.5.h.2 Initial Test The owner/operator shall conduct an initial stack test on the emission unit within 180 days after startup of the emission unit. [R307-165-2] II.B.5.h.3 Test Frequency The owner/operator shall conduct a stack test on the emission unit within three (3) years after the date of the most recent stack test of the emission unit. The Director may require the owner/operator to perform a stack test at any time. [R307-165-2, R307-401-8] II.B.6 Stack Testing Requirements II.B.6.a The owner/operator shall conduct any stack testing required by this AO according to the following conditions. [R307-401-8] II.B.6.a.1 Notification At least 30 days prior to conducting a stack test, the owner/operator shall submit a source test protocol to the Director. The source test protocol shall include the items contained in R307-165-3. If directed by the Director, the owner/operator shall attend a pretest conference. [R307-165-3, R307-401-8] II.B.6.a.2 Testing & Test Conditions The owner/operator shall conduct testing according to the approved source test protocol and according to the test conditions contained in R307-165-4. [R307-165-4, R307-401-8] II.B.6.a.3 Access The owner/operator shall provide Occupational Safety and Health Administration (OSHA)- or Mine Safety and Health Administration (MSHA)-approved access to the test location. [R307-401-8] II.B.6.a.4 Reporting No later than 60 days after completing a stack test, the owner/operator shall submit a written report of the results from the stack testing to the Director. The report shall include validated results and supporting information. [R307-165-5, R307-401-8] II.B.6.a.5 Possible Rejection of Test Results The Director may reject stack testing results if the test did not follow the approved source test protocol or for a reason specified in R307-165-6. [R307-165-6, R307-401-8] II.B.6.b Test Methods When performing stack testing, the owner/operator shall use the appropriate EPA-approved test methods as acceptable to the Director. Acceptable test methods for pollutants are listed below. [R307-401-8] DAQE-IN158520002-22 Page 15 II.B.6.b.1 Standard Conditions A. Temperature - 68 degrees Fahrenheit (293 K) B. Pressure - 29.92 in Hg (101.3 kPa) C. Averaging Time - As specified in the applicable test method [40 CFR 60 Subpart A, 40 CFR 63 Subpart A, R307-401-8] II.B.6.b.2 Filterable PM10 40 CFR 60, Appendix A, Method 5; 40 CFR 51, Appendix M, Method 201; Method 201A; or other EPA-approved testing method as acceptable to the Director. If other approved testing methods are used which cannot measure the PM10 fraction of the filterable particulate emissions, all of the filterable particulate emissions shall be considered PM10. [R307-401-8] II.B.6.b.3 Filterable PM2.5 40 CFR 60, Appendix A, Method 5; 40 CFR 51, Appendix M, Method 201A or other EPA- approved testing method as acceptable to the Director. If other approved testing methods are used which cannot measure the PM2.5 fraction of the filterable particulate emissions, all of the filterable particulate emissions shall be considered PM2.5. [R307-401-8] II.B.6.b.4 Condensable PM 40 CFR 51, Appendix M, Method 202 or other EPA-approved testing method as acceptable to the Director. [R307-401-8] PERMIT HISTORY This Approval Order shall supersede (if a modification) or will be based on the following documents: Supersedes AO DAQE-AN158520001-18 dated November 29, 2018 Is Derived From NOI dated February 2, 2022 Incorporates Additional Information Received dated March 11, 2022 Incorporates Additional Information Received dated April 4, 2022 Incorporates Additional Information Received dated September 1, 2022 Incorporates DAQE-MN158520002-22 dated September 9, 2022 DAQE-IN158520002-22 Page 16 ACRONYMS The following lists commonly used acronyms and associated translations as they apply to this document: 40 CFR Title 40 of the Code of Federal Regulations AO Approval Order BACT Best Available Control Technology CAA Clean Air Act CAAA Clean Air Act Amendments CDS Classification Data System (used by Environmental Protection Agency to classify sources by size/type) CEM Continuous emissions monitor CEMS Continuous emissions monitoring system CFR Code of Federal Regulations CMS Continuous monitoring system CO Carbon monoxide CO2 Carbon Dioxide CO2e Carbon Dioxide Equivalent - Title 40 of the Code of Federal Regulations Part 98, Subpart A, Table A-1 COM Continuous opacity monitor DAQ/UDAQ Division of Air Quality DAQE This is a document tracking code for internal Division of Air Quality use EPA Environmental Protection Agency FDCP Fugitive dust control plan GHG Greenhouse Gas(es) - Title 40 of the Code of Federal Regulations 52.21 (b)(49)(i) GWP Global Warming Potential - Title 40 of the Code of Federal Regulations Part 86.1818- 12(a) HAP or HAPs Hazardous air pollutant(s) ITA Intent to Approve LB/YR Pounds per year MACT Maximum Achievable Control Technology MMBTU Million British Thermal Units NAA Nonattainment Area NAAQS National Ambient Air Quality Standards NESHAP National Emission Standards for Hazardous Air Pollutants NOI Notice of Intent NOx Oxides of nitrogen NSPS New Source Performance Standard NSR New Source Review PM10 Particulate matter less than 10 microns in size PM2.5 Particulate matter less than 2.5 microns in size PSD Prevention of Significant Deterioration PTE Potential to Emit R307 Rules Series 307 R307-401 Rules Series 307 - Section 401 SO2 Sulfur dioxide Title IV Title IV of the Clean Air Act Title V Title V of the Clean Air Act TPY Tons per year UAC Utah Administrative Code VOC Volatile organic compounds DAQE-NN158520002A-22 December 22, 2022 The Daily Herald Legal Advertising Dept 1555 N 200 W Provo, UT 84601 RE: Legal Notice of Intent to Approve This letter will confirm the authorization to publish the attached NOTICE in The Daily Herald on December 23, 2022. Please mail the invoice and affidavit of publication to the Utah State Department of Environmental Quality, Division of Air Quality, P.O. Box 144820, Salt Lake City, Utah 84114-4820. If you have any questions, contact Jeree Greenwood, who may be reached at (385) 306-6514. Sincerely, {{$s }} Jeree Greenwood Office Technician Enclosure cc: Utah County cc: Mountainland Association of Governments 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 903-3978 www.deq.utah.gov Printed on 100% recycled paper State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director DAQE-NN158520002A-22 Page 2 NOTICE A Notice of Intent for the following project submitted in accordance with R307-401-1, Utah Administrative Code (UAC), has been received for consideration by the Director: Company Name: Kilgore Companies, LLC Location: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant – 7200 South 5600 West, Benjamin, UT Project Description: Kilgore Contracting, LLC (Kilgore) operates the Benjamin Pit asphalt and aggregate processing plant in Utah County. Kilgore has requested a modification to its Approval Order. The modification includes a request to increase aggregate production to 800,000 tons per year, to increase hot mix asphalt production to 250,000 tons per year, and to add one 40-ton fly ash silo. The completed engineering evaluation and air quality impact analysis showed the proposed project meets the requirements of federal air quality regulations and the State air quality rules. The Director published the Intent to issue an Approval Order for this project on November 30, 2022, which started a 30-day public comment period. Within 15 days of the start of the public comment period, an extension to the public comment period and a public hearing were requested. In accordance with UAC R307-401-7, the public comment period will be extended and a public hearing will be held on January 26, 2023. The hearing will be held in the Choir Room of the Spanish Fork High School, 99 N 300 W, Spanish Fork, UT 84660, beginning at 6:00 pm and will be held for at least one hour. The project proposal, estimate of the effect on local air quality, and draft Approval Order are available for public inspection and comment at the Utah Division of Air Quality, 195 North 1950 West, Salt Lake City, UT 84116. Comments received at the public hearing and written comments received by the Division on or before January 29, 2023 will be considered in making the final decision on the approval/disapproval of the proposed project. Email comments will also be accepted at cbodell@utah.gov. The proposed conditions of the Approval Order may be changed as a result of the comments received. Under Section 19-1-301.5, a person who wishes to challenge a Permit Order may only raise an issue or argument during an adjudicatory proceeding that was raised during the public comment period and was supported with sufficient information or documentation to enable the Director to fully consider the substance and significance of the issue. Date of Notice: December 23, 2022 {{#s=Sig_es_:signer1:signature}} DAQE- RN158520002 November 3, 2022 Lee Ware Kilgore Companies, LLC 7057 West 2100 South Salt Lake City, UT 84128 lee.ware@kilgorecompanies.com Dear Lee Ware, Re: Engineer Review: Minor Modification to Approval Order DAQE-AN158520001-18 to Increase Production Project Number: N158520002 The DAQ requests a company representative review and sign the attached Engineer Review (ER). This ER identifies all applicable elements of the New Source Review permitting program. Kilgore Companies, LLC should complete this review within 10 business days of receipt. Kilgore Companies, LLC should contact Christine Bodell at (385) 290-2690 if there are questions or concerns with the review of the draft permit conditions. Upon resolution of your concerns, please email cbodell@utah.gov the signed cover letter to Christine Bodell. Upon receipt of the signed cover letter, the DAQ will prepare an ITA for a 30-day public comment period. At the completion of the comment period, the DAQ will address any comments and will prepare an AO for signature by the DAQ Director. If Kilgore Companies, LLC does not respond to this letter within 10 business days, the project will move forward without source concurrence. If Kilgore Companies, LLC has concerns that cannot be resolved and the project becomes stagnant, the DAQ Director may issue an Order prohibiting construction. Approval Signature _____________________________________________________________ 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 903-3978 www.deq.utah.gov Printed on 100% recycled paper Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor 11/16/2022 Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 1 UTAH DIVISION OF AIR QUALITY ENGINEER REVIEW SOURCE INFORMATION Project Number N158520002 Owner Name Kilgore Companies, LLC Mailing Address 7057 West 2100 South Salt Lake City, UT, 84128 Source Name Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant Source Location 7200 South 5600 West Benjamin, UT 84660 UTM Projection 431,360 m Easting, 4,439,030 m Northing UTM Datum NAD83 UTM Zone UTM Zone 12 SIC Code 1442 (Construction Sand & Gravel) Source Contact Lee Ware Phone Number (801) 831-7402 Email lee.ware@kilgorecompanies.com Project Engineer Christine Bodell, Engineer Phone Number (385) 290-2690 Email cbodell@utah.gov Notice of Intent (NOI) Submitted February 2, 2022 Date of Accepted Application September 8, 2022 Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 2 SOURCE DESCRIPTION General Description Kilgore Contracting, LLC (Kilgore) operates the Benjamin Pit asphalt and aggregate processing plant in Utah County. Standard aggregate and hot mix asphalt (HMA) equipment such as crushers, screens, stockpiles, hoppers, conveyors, silos, and storage tanks are present on site. The aggregate facility utilizes line power to power on site crushers and screens. Aggregate materials are fed into crushers and screens after on-site drilling and blasting. Aggregates cycle through the crushers and screens to achieve appropriate sizing and are stored on location before being trucked off site or to the asphalt plant. The asphalt plant mixes aggregate, asphalt oil, lime, and fly ash to produce hot mix asphalt. NSR Classification: Minor Modification at Minor Source Source Classification Located in Southern Wasatch Front O3 NAA, Provo UT PM2.5 NAA Utah County Airs Source Size: SM Applicable Federal Standards NSPS (Part 60), A: General Provisions NSPS (Part 60), I: Standards of Performance for Hot Mix Asphalt Facilities NSPS (Part 60), OOO: Standards of Performance for Nonmetallic Mineral Processing Plants Project Proposal Minor Modification to Approval Order DAQE-AN158520001-18 to Increase Production Project Description Kilgore Contracting, LLC (Kilgore) has requested modification to the Benjamin Pit AO. The source has proposed to increase processed aggregate production by 200,000 tpy for a total of 800,000 tpy and to increase HMA production by 40,000 tpy, for a total of 250,000 tpy. One (1) 40-ton fly ash silo will be added. Condition II.B.3.h was updated to reflect the updated control mechanism of water cannon and/or water truck spray to storage piles. Due to the varying heights and locations of the storage piles, spray bars were found to be technically limiting. Water cannon and/or water truck spray were found to be equally as efficient for water-based controls. No other equipment will be added or modified as a result of this change. EMISSION IMPACT ANALYSIS The emission rates for PM10 triggered the requirement for Kilgore to conduct modeling under Utah Administrative Code R307-410. The UDAQ conducted 24-hour PM10 modeling analysis. The results indicated that the highest PM10 impact would be 99.2% of NAAQS levels. The UDAQ also conducted 1-hour NO2 and annual NO2 modeling analysis. The results indicated that the highest 1-hour NO2 and annual NO2 impacts would be 94.3% of the NAAQS levels and 16.5% of the NAAQS levels, respectively. To ensure NAAQS levels are not exceeded, the following conditions were added to the AO: Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 3 1. Blasting operations are limited to between 10:00 am and 2:00 pm daily. 2. Drilling emissions are limited to between 7:00 am and 5:00 pm daily. 3. Operation of the HMA Plant and associated facility activities shall not operate during January and February of each year. See modeling memorandum DAQE-MN158520002-22 for more information. [Last updated October 31, 2022] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 4 SUMMARY OF EMISSIONS The emissions listed below are an estimate of the total potential emissions from the source. Some rounding of emissions is possible. Criteria Pollutant Change (TPY) Total (TPY) CO2 Equivalent -2199.53 3041.60 Carbon Monoxide 2.93 19.22 Nitrogen Oxides -1.97 4.44 Particulate Matter - PM10 5.99 18.79 Particulate Matter - PM2.5 2.29 7.72 Sulfur Dioxide 2.30 7.25 Volatile Organic Compounds 1.04 6.21 Hazardous Air Pollutant Change (lbs/yr) Total (lbs/yr) Acetaldehyde (CAS #75070) 53 326 Formaldehyde (CAS #50000) 126 796 Generic HAPs (CAS #GHAPS) 33 440 Hexane (CAS #110543) 36 234 Naphthalene (CAS #91203) 26 165 Toluene (CAS #108883) 112 730 Change (TPY) Total (TPY) Total HAPs 0.20 1.35 Note: Change in emissions indicates the difference between previous AO and proposed modification. Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 5 Review of BACT for New/Modified Emission Units 1. BACT review regarding Screens, Crushers, and Conveyors The pollutants from aggregate processing are PM10 and PM2.5. The requested change will result in an increase of 0.24 tpy of PM10 and 0.06 tpy of PM2.5. Common control technologies for particulate control include utilizing total equipment enclosures, electrostatic precipitators (ESPs), wet scrubbers, baghouses (fabric filters), cyclone separators, and wet suppression. Total enclosure of the equipment provide control up to 90%; ESP's and baghouses typically reduce PM10 and PM2.5 emissions by up to 99.9%. Wet scrubbers offer approximately 95% control and wet suppression offers approximately 75% control. Cyclone separators typically reduce emissions of PM2.5 by 20- 70% and PM10 by 60-95%. Baghouse control is often accomplished through installation of ductwork, capture hoods, fans, motors, and other station equipment. The cost to enclose the crushers and install the needed duct work and baghouse is cost prohibitive for the material handling operations. Additionally, the Crushing and Screening Operation circuit is made up of crushers, screens, mobile conveyors, and stackers. The circuit requires flexibility to alter on-site stockpile configurations and the location of crushing and screening operations. This configuration is incompatible with stationary baghouse equipment and therefore technically infeasible. The use of cyclone separators, ESP's, enclosures, and wet scrubbers are also infeasible for the same reasons as using baghouse control. Wet suppression using water sprays nozzles or fog bars are effective in minimizing emissions. Wet suppression through use of a high-pressure watering system will be employed on all crushers, screens, and conveyor transfer points. The Benjamin Pit facility will ensure water is applied as necessary to maintain a high moisture content. Therefore, BACT to control particulate emissions from aggregate processing is the application of water. BACT requirements for aggregate processing is the use of water sprays to meet the following opacity limitations applicable to process equipment: Crushers - 12% Screens - 7% Conveyor Transfer Points - 7% Additionally, best operating practices. such as regular inspection and maintenance, will be implemented and considered BACT. [Last updated October 31, 2022] 2. BACT review regarding Haul Roads PM10 and PM2.5 are emitted as fugitive dust from haul roads. The requested change will result in a total of 1.92 tpy of PM10 and 0.19 tpy PM2.5. Controls for existing paved areas include sweeping, vacuum sweeping and/or watering. Combining vacuum sweeping and watering provides the highest control efficiency at 95% and is considered BACT. For existing and proposed unpaved areas where the haul trucks will be operating, control technologies include paving, water application combined with use of road base, and application of a chemical dust suppressant combined with use of road base. Paving most of the roads on site is not technically feasible as the plant operations are dynamic and route configurations are subject to change according to plant development. Watering and use of a road base provide a control efficiency at 75%. Combining chemical suppressant and watering provides the highest control efficiency at 85% and is considered BACT. Silt reduction by using recycled asphalt pavement Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 6 (RAP) as a road base will also be utilized. All haul roads on site will be treated as necessary to maintain the opacity limitations in R307-309- 5. Treatment will therefore be used to limit fugitive dust emissions to maintain visible emissions at or below 20% opacity on site and 10% opacity at the property boundary. Additional control options include best engineering practices; minimizing haul road length and vehicle miles traveled, site wide speed limits, and regular maintenance. These practices will be addressed in the site wide fugitive dust control plan. Records of on-site treatments will be recorded and kept on site for review. These control strategies are considered BACT for haul roads. [Last updated October 31, 2022] 3. BACT review regarding Drilling and Blasting The requested change will result in an increase of 0.03 tpy of PM10, 0.03 tpy of NOx, 0.67 tpy of CO, and less than 0.01 tpy of PM2.5 and SO2 (each), from drilling and blasting operations. Drilling occurs on site to allow access to subsurface aggregate materials. As the drill agitates and loosens surrounding soils, fugitive PM10 and PM2.5 emissions are generated. Controls include drill mounted water sprays (water injection) or drill shrouds. Drill mounted water sprays (water injection) is a wet drilling technique where water or water plus a wetting agent or surfactant is injected into the compressed air stream particles so that the particles drop to the drill collar as damp pellets. Drill shrouds have a control efficiency of approximately 75%. Water injection requires less maintenance and equipment, but has a control efficiency of 96%. Therefore, BACT to control particulate emissions from drilling operations is the use of drill mounted water sprays (water injection) in conjunction with use of a shroud. Blasting operations are employed to move and access large areas of aggregate material. The blast loosens large areas of aggregate that will later be crushed, screen, and transferred off site. For blasting to occur, multiple holes are drilled in the parent material. A detonation charge is placed into each borehole, after which the borehole is filled with ammonium nitrate fuel oil (ANFO). Fugitive particulate (PM10), NOx, and CO emissions will be emitted from blasting operations. To reduce particulate emissions, the only current practical technology is the use of good management practices. A fugitive dust control plan that outlines the methods to be employed to control and mitigate fugitive dust emissions will be utilized by Kilgore. Thus, BACT for blasting is sound operating practices and good process design. Blasting will be conducted during low wind events, when possible, and in such a manner to prevent overshoot. When the explosives are ignited, the primary pollutants also include NOx, CO, and SO2. No control technologies were identified to control these emissions except the use of best management practices. The amount of ANFO to be detonated will be limited during each blast to reduce emissions. Thus, BACT for NOx, CO, and SO2 emissions is best management practices and limiting the amount of explosive used per blast. [Last updated September 27, 2022] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 7 4. BACT review regarding Hot Mix Asphalt Operations HMA Plants generate PM10, PM2.5, SO2, NO2, CO, VOCs, and HAPs emissions from fuel and aggregate heating in the drum mixer, pneumatic loading and unloading of the storage silos, and combustion of RFO in the hot oil heater. The requested change will result in an increase of 0.51 tpy of PM10, 0.50 tpy of PM2.5, 1.16 tpy of NOx, 2.71 tpy of CO, 1.16 tpy of SO2, 0.98 tpy of VOCs, and 0.20 tpy of HAPs. Control options and their efficiencies for PM10 and PM2.5 emissions include scrubbers (85%) and baghouses (95%). Sources with a high quantity of large particles or a high temperature outlet gas may also incorporate dry mechanical collectors, such as a cyclone, as a precursor to scrubbers or baghouses. The baghouse has the greatest control efficiency and was selected as the control for PM10 and PM2.5 emissions. Scrubbers can capture some VOC, HAP, SO2, NOx, and CO emissions. However, a greater reduction in PM10 and PM2.5 is achieved through the use of a baghouse. In order to achieve the greatest control for PM in the nonattainment area, the baghouse is preferable to the use of a scrubber. Therefore, BACT to control PM10 and PM2.5 emissions is the use of a baghouse on all storage silos (lime, fly ash, and asphalt) and the asphalt plant drum mixer. To ensure efficiencies and emission limitations are met, the source is required to stack test the HMA plant, operate the baghouses according to the manufacturer's specifications, and maintain visible emissions at or below 10% opacity. The hot mix asphalt plant will burn waste oil as the main fuel source. The plant will adhere to the requirements in R307-312-5 for burning a fuel other than natural gas or liquefied petroleum gas (LPG). As required under Utah Rules, control for NOx emissions is the use of a low NOx burner that meet the specifications given in UAC R307-401-4(3). Other control options are not technically feasible. Emissions of CO and VOC will be controlled by following manufacturer recommended practices, including proper fuel mixing in the combustion zone, maintaining high temperatures and low oxygen levels in the primary zone, maximizing burner efficiency, and allowing sufficient residence time to complete combustion. SO2 emissions will be minimized by using ultra-low sulfur fuel. The recycled fuel oil (RFO) will be analyzed for its sulfur content. Kilgore will ensure that the sulfur content of the RFO does not exceed 0.3%. Additional requirements on fuel testing, reporting, and recording as required. This and maintaining visible emissions at or below 10% opacity are BACT for the hot mix asphalt dryer. [Last updated October 31, 2022] 5. BACT review regarding Wind Erosion of Exposed Areas The requested changes will result in an increase in 2.07 tpy of PM10 and 1.22 tpy of PM2.5 from stockpiles and disturbed area. During the mining process, stripped overburden or graded overburden from initial removal until when vegetation starts to grow has the potential to emit fugitive PM10 and PM2.5 from wind and dry climatic conditions. There are currently no add-on control devices to limit the emissions from exposed areas. However, different operational practices can be considered for BACT. One option is to spray water on all areas not covered with vegetation or synthetic material. Kilgore will apply water to control fugitive dust emissions to maintain opacity limits. Fugitive particulate (PM10/PM2.5) emissions will be emitted from the outdoor storage piles from material loading and unloading as well as wind. Common control options for storage piles include water application, full enclosure, or partial enclosure. The Benjamin Pit site will have up to 18 Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 8 acres of storage piles throughout the property. It is not practically feasible at aggregate, sand, or gravel operations to fully enclose the piles due to cost and the dynamic nature and the location change of mining operations. Partial enclosures can be more accommodating, but are still cost prohibitive and require water sprays to maintain opacity limits. Water application via spray bar systems, water cannons, or water trucks are relatively inexpensive and offer approximately 75% control efficiency of fugitive emissions. Water application via water cannons and/or water trucks to maintain visible emissions at or below 20% opacity on-site and 10% at the site boundary is considered BACT for storage piles. [Last updated September 27, 2022] 6. BACT review regarding Aggregate Loading and Unloading and Bulldozing/Loader Operations: PM10 and PM2.5 are emitted as fugitive dust from loading, unloading, bulldozing, and loader operations. The requested change will result in an increase in 1.37 tpy of PM10 and 0.29 tpy of PM2.5. Disturbances in aggregate generate dust as materials are loaded and unloaded. Operational controls to reduce PM10 and PM2.5 emissions include chemical treatment and water. Chemical treatment is technically infeasible due to the impacts of treatment on the aggregate. Therefore, fugitive emissions from loading and unloading can be limited by maintaining material moisture through water. Application of water onto crushed aggregate in operations before loading, during material processing and at storage piles, will sustain moisture content through storage and loading. Best management practices also reduce emissions. Examples of best management practices include the methods and strategies to control fugitive dust listed in R307-309. Best management practices to maintain visible emissions at or below 20% opacity will be considered BACT for aggregate loading and unloading. Aggregate materials on site are repositioned, deposited, and moved around using front end loaders. Possible controls for bulldozing operations are water sprays and best management practices to reduce fugitive dust. Water applied would only coat the surface of the materials. Once the bulldozers disturb the surface, the applied water would no longer be effective. The area impacted by bulldozing operations is vast and difficult to saturate. Due to the size of the area, and the small amount of emissions controlled in this method, water sprays are not technically or economically feasible. Therefore, water sprays were eliminated as is BACT. Best management practices include different strategies to reduce fugitive dust such as limiting bulldozing routes and lengths and maintaining visible emission at or below 20% opacity. The use of best management practices (such as minimizing drop distance will also be employed) and maintaining opacity limitations is considered BACT for bulldozing. [Last updated October 31, 2022] SECTION I: GENERAL PROVISIONS The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. (New or Modified conditions are indicated as “New” in the Outline Label): Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 9 I.1 All definitions, terms, abbreviations, and references used in this AO conform to those used in the UAC R307 and 40 CFR. Unless noted otherwise, references cited in these AO conditions refer to those rules. [R307-101] I.2 The limits set forth in this AO shall not be exceeded without prior approval. [R307-401] I.3 Modifications to the equipment or processes approved by this AO that could affect the emissions covered by this AO must be reviewed and approved. [R307-401-1] I.4 All records referenced in this AO or in other applicable rules, which are required to be kept by the owner/operator, shall be made available to the Director or Director's representative upon request, and the records shall include the two-year period prior to the date of the request. Unless otherwise specified in this AO or in other applicable state and federal rules, records shall be kept for a minimum of two (2) years. [R307-401-8] I.5 At all times, including periods of startup, shutdown, and malfunction, owners and operators shall, to the extent practicable, maintain and operate any equipment approved under this AO, including associated air pollution control equipment, in a manner consistent with good air pollution control practice for minimizing emissions. Determination of whether acceptable operating and maintenance procedures are being used will be based on information available to the Director which may include, but is not limited to, monitoring results, opacity observations, review of operating and maintenance procedures, and inspection of the source. All maintenance performed on equipment authorized by this AO shall be recorded. [R307- 401-4] I.6 The owner/operator shall comply with UAC R307-107. General Requirements: Breakdowns. [R307-107] I.7 The owner/operator shall comply with UAC R307-150 Series. Emission Inventories. [R307- 150] I.8 The owner/operator shall submit documentation of the status of construction or modification to the Director within 18 months from the date of this AO. This AO may become invalid if construction is not commenced within 18 months from the date of this AO or if construction is discontinued for 18 months or more. To ensure proper credit when notifying the Director, send the documentation to the Director, attn.: NSR Section. [R307-401-18] SECTION II: PERMITTED EQUIPMENT The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. (New or Modified conditions are indicated as “New” in the Outline Label): II.A THE APPROVED EQUIPMENT II.A.1 Benjamin Aggregate & Asphalt Plant II.A.2 Aggregate Plant Crushing, screening, hauling, conveying, and storing Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 10 II.A.3 One (1) Jaw Crusher Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.4 One (1) Cone Crusher Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.5 One (1) Vertical Shaft Impactor Crusher Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.6 Three (3) Triple Deck Screens Size: 8' x 20' Capacity: 400 TPH Each NSPS Applicability: Subpart OOO II.A.7 Various Aggregate Conveyors NSPS Applicability: Subpart OOO II.A.8 Miscellaneous Equipment feeders, conveyors, stackers, wash screws, wash screes, etc. II.A.9 Asphalt Plant Production of Hot Mix Asphalt II.A.10 One (1) Asphalt Mix Drum Drum Rated Capacity: 400 TPH Hot Oil Burner Rating: 165 MMBtu/hr Control: Baghouse NSPS Applicability: Subpart I II.A.11 One (1) Scalping Screen Size: 6' x 20' Capacity: 400 TPH NSPS Applicability: Subpart OOO II.A.12 One (1) Hot Oil Heater Rating: < 0.25 MMBtu/hr Control: Low NOx Burner II.A.13 One (1) Waste Oil Storage Tank Maximum Capacity: 15,000 gallons II.A.14 Three (3) Asphalt Oil Storage Tanks Maximum Capacity: 30,000 gallons Each NSPS Applicability: Subpart I Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 11 II.A.15 One (1) Lime Silo Maximum Capacity: 40 Tons Control: Baghouse NSPS Applicability: Subpart I II.A.16 Three (3) Asphalt Storage Silos Maximum Capacity: 300 Tons Each Control: Baghouse NSPS Applicability: Subpart I II.A.17 NEW One (1) Fly Ash Silo (New) Maximum Capacity: 40 Tons Control: Baghouse NSPS Applicability: Subpart I II.A.18 Five (5) Diesel Storage Tanks Maximum Capacity: 6,000 Gallons Total SECTION II: SPECIAL PROVISIONS The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. (New or Modified conditions are indicated as “New” in the Outline Label): II.B REQUIREMENTS AND LIMITATIONS II.B.1 Site Wide Requirements II.B.1.a Unless otherwise specified in this AO, the owner/operator shall not allow visible emissions from any source on site to exceed 20% opacity. [R307-201-3, R307-401-8] II.B.1.b Unless otherwise specified in this AO, opacity observations of visible emissions from stationary sources shall be conducted according to 40 CFR 60, Appendix A, Method 9. [R307- 201-3] II.B.2 Aggregate Pit Requirements II.B.2.a NEW The owner/operator shall not produce more than 800,000 tons of processed aggregate material per rolling 12-month period. [R307-401-8] II.B.2.a.1 NEW The owner/operator shall: A. Determine production by scale house records or vendor receipts. B. Record production on a daily basis C. Use the production data to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months D. Keep the production records for all periods the plant is in operation. [R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 12 II.B.2.b NEW Visible emissions from the following emission points shall not exceed the following values: A. Crushers - 12% opacity B. Screens - 7% opacity C. All Conveyor Transfer Points - 7% opacity. [R307-312, R307-401-8] II.B.2.c The owner/operator shall install water sprays on all crushers, all screens, all conveyor transfer points, and all conveyor drop points to control emissions. Sprays shall operate as required to ensure the opacity limits in this AO are not exceeded. [R307-401-8] II.B.2.d The owner/operator shall perform monthly periodic inspections to check that water is flowing to discharge spray nozzles associated with each crusher, screen, and conveyor. If the owner/operator finds that water is not flowing properly during an inspection of the water spray nozzles, the owner/operator shall initiate corrective action within 24 hours and complete corrective action as expediently as practical. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.d.1 NEW Records of the water sprays inspections shall be kept and maintained in a logbook for all periods when the plant is in operation. The records shall include the following items: A. Date the inspections were made B. Any corrective actions taken C. Control mechanism used if sprays are not operating. [40 CFR 60 Subpart OOO, R307- 401-8] II.B.2.e The owner/operator shall conduct an initial performance test for all crushers, screens, and conveyor transfer points on site within 60 days after achieving maximum production rate but not later than 180 days after initial startup. Performance tests shall meet the limitations specified in Table 3 of Subpart OOO. Records of initial performance tests shall be kept and maintained on site for the lifetime of the equipment. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.e.1 Initial performance tests for fugitive emission limits shall be conducted according to 40 CFR 60.675(c). The owner/operator may use methods and procedures specified in 40 CFR 60.675(e) an alternative. [40 CFR 60 Subpart OOO, R307-401-8] II.B.2.e.2 The owner/operator shall submit written reports of the results of all performance tests conducted to demonstrate compliance with 40 CFR 60.672 to the Director, attn.: Compliance Section. The submission shall be postmarked no later than 180 days from the date of this AO or no later than 180 days from equipment start-up, whichever is later. [40 CFR 60 Subpart OOO, R307-401-8] II.B.3 All Haul Roads and Fugitive Dust Sources Requirements II.B.3.a NEW The owner/ operator shall not exceed the following: A. 18.00 acres of storage pile and disturbed ground combined B. 9,980 feet (1.89 miles) of unpaved haul roads. [R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 13 II.B.3.a.1 Compliance shall be determined through GPS measurements or aerial photographs. Reclaimed areas such as those with emerged vegetation or hydro-seeded do not contribute to the acreage totals. [R307-401-8] II.B.3.b The owner/operator shall ensure the entry haul road is paved for no less than 3,000 feet (0.57 miles) in length. [R307-401-8] II.B.3.b.1 The paved road length shall be determined through source records or GPS measurements. [R307-401-8] II.B.3.c NEW The owner/operator shall not allow visible emissions to exceed the following: A. Haul roads --20% opacity B. Storage Piles -- 10% opacity C. All other fugitive dust sources-- 20% opacity D. All sources at the property boundary--10% opacity. [R307-309-5] II.B.3.d Visible emission determinations for fugitive dust from haul roads and operational areas shall use procedures similar to Method 9. The normal requirement for observations to be made at 15-second intervals over a six-minute period, however, shall not apply. Visible emissions shall be measured at the densest point of the plume but at a point not less than one-half vehicle length behind the vehicle and not less than one-half the height of the vehicle. [R307-309-5] II.B.3.e NEW The owner/operator shall comply with a fugitive dust control plan (FDCP) consistent with R307-309-6. [R307-309-6, R307-401-8] II.B.3.f NEW The owner/operator shall comply with all applicable requirements of R307-309 for Fugitive Emission and Fugitive Dust sources on site. [R307-309, R307-401-8] II.B.3.g NEW An operational sweeper and water truck shall be made available during each operating day. The owner/operator shall vacuum sweep and flush with water all the paved haul roads on site to maintain opacity limits listed in this AO. If the temperature is below freezing, the owner/operator shall continue to vacuum sweep the road but may stop flushing the paved haul roads with water. Flushing the paved haul road with water shall resume when the temperature is above freezing. If the haul roads are covered with snow or ice, the owner/operator may stop vacuum sweeping the paved haul roads. Vacuum sweeping the paved haul roads shall resume when the haul roads are cleared from snow and ice. [R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 14 II.B.3.g.1 NEW Records of vacuum sweeping and water application shall be kept for all periods when the plant is in operation. The records shall include the following items: A. Date and time treatments were made B. Number of treatments made and quantity of water applied C. Rainfall amount received, if any D. Records of temperature, if the temperature is below freezing E. Records shall note if the paved haul roads are covered with snow or ice. [R307-401-8] II.B.3.h NEW The owner/operator shall cover all unpaved haul roads and wheeled-vehicle operational areas with road base material, and an operational water truck shall be made available during each operating day. The owner/operator shall use chemical suppressant and water application to maintain opacity limits listed in this AO. If the temperature is below freezing, the owner/operator may stop applying chemical suppressant and water to the unpaved haul roads and wheeled-vehicle operational areas. The owner/operator shall resume applying chemical suppressant and water to the unpaved haul roads and wheeled-vehicle operational areas when the temperature is above freezing. [R307-401-8] II.B.3.h.1 NEW Records of chemical suppressant and water application shall be kept for all periods when the plant is in operation. The records shall include the following items: A. Date and time treatments were made B. Number of treatments made, quantity of water applied, and chemical dilution ratio used C. Rainfall amount received, if any D. Records of temperature, if the temperature is below freezing. [R307-401-8] II.B.3.i NEW The owner/operator shall control particulate emissions from storage piles using water trucks and/or water cannons. The water trucks and/or water cannons shall operate as required to ensure the opacity limits in this AO are not exceeded. [R307-401-8] II.B.3.i.1 NEW Records of water application to the storage piles kept for all periods when the plant is in operation. The records shall include the following items: A. The date, time, and location of applications. B. The volume of water applied. [R307-401-8] II.B.3.j The owner/operator shall not exceed 1,800 bulldozing hours per rolling 12-month period. [R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 15 II.B.3.j.1 NEW The owner/operator shall: A. Determine hours of operation with a supervisor monitoring and maintaining an operations log. The hours of operation of each bulldozer shall be added together to determine the total hours. B. Record hours of operation each day C. Use the hours of operation to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months D. Keep hours of operation records for all periods the plant is in operation. [R307-401-8] II.B.3.k NEW The owner/operator shall not conduct blasting operations before 10:00 am or after 2:00 pm each day. [R307-401-8] II.B.3.k.1 NEW The owner/operator shall keep and maintain the following records of operation for all periods of blasting: A. Time blasting operations begin each day B. Time blasting operations end each day. [R307-401-8] II.B.3.l NEW The owner/operator shall not exceed the following blasting limits: A. 30 blasts per rolling 12-month period B. 126 tons of ANFO used per rolling 12-month period. C. An area of 6,262 square feet blasted per blast. [R307-401-8] II.B.3.l.1 NEW Records of blasts shall be kept for all periods when the plant is in operation. The records shall include the following: A. Date of each blast B. Area of each blast C. Tons of ANFO used for each blast. The owner/operators shall use the records to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months. [R307-401-8] II.B.3.m NEW The owner/operator shall not conduct drilling operations before 7:00 am or after 5:00 pm each day. [R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 16 II.B.3.m.1 NEW The owner/operator shall keep and maintain the following records of operation for all periods of drilling: A. Time drilling operations begin each day B. Time drilling operations end each day. [R307-401-8] II.B.3.m.2 NEW The owner/operator shall control emissions from drilling operations with the use of drill mounted water sprays (water injection) and drill shrouds. [R307-401-8] II.B.4 Hot Mix Asphalt Plant Operating Requirements II.B.4.a NEW The owner/operator shall not produce more than 250,000 tons of hot mix asphalt per rolling 12-month period. [R307-401-8] II.B.4.a.1 NEW The owner/operator shall: A. Determine production by the belt scale on the initial feeder, vendor receipts, or other methods approved by the Director. B. Record production on a daily basis C. Use the production data to calculate a new rolling 12-month total by the 20th day of each month using data from the previous 12 months D. Keep the production records for all periods the plant is in operation. [R307-401-8] II.B.4.b NEW The owner/operator shall not operate the hot mix asphalt plant during the months of January and February. [R307-401-8] II.B.4.b.1 NEW Records of operation shall be kept for all periods when the plant is in operation. Supervisor monitoring and maintaining of an operations log shall determine days of operation. [R307- 312, R307-401-8] II.B.4.c The owner/operator shall use natural gas, propane, fuel oil, or on-specification used oil as defined in R315-15, or any combination thereof as fuel in the hot mix asphalt plant. [R307- 401-8] II.B.4.d The sulfur content of any fuel oil burned in the hot mix asphalt plant shall not exceed 15 ppm by weight. [R307-401-8] II.B.4.d.1 The sulfur content shall be determined by ASTM Method D2880-71, D4294-89, or approved equivalent. Certification of fuel oil shall be either by the owner/operator's own testing or by test reports from the fuel oil marketer. [R307-203-1, R307-401-8] II.B.4.d.2 The owner/operator shall keep and maintain records of the test certification of sulfur content in fuel oil. Records of the test certifications shall be kept for all periods when the plant is in operation. [R307-203-1, R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 17 II.B.4.e The owner/operator shall comply with the limitations and compliance requirements under R307-312-5 for burning a fuel other than natural gas or liquefied petroleum gas (LPG). [R307- 312] II.B.4.f NEW The owner/operator shall maintain fuel records for the months of November and December. [R307-401-8] II.B.5 NEW Baghouse Requirements II.B.5.a NEW The owner/operator shall equip each lime, fly ash, and asphalt storage silo with a baghouse to control particulate emissions generated during filling and emptying of the silos. Each baghouse shall be used during all periods of loading and unloading. [R307-401-8] II.B.5.b NEW The owner/operator shall not allow visible emissions from any baghouse to exceed 10% opacity. [R307-401-8] II.B.5.c NEW The owner/operator shall install a manometer or magnehelic pressure gauge to measure the differential pressure across each baghouse. [R307-401-8] II.B.5.c.1 NEW Each pressure gauge shall be located such that an inspector/operator can safely read the indicator at any time. [R307-401-8] II.B.5.c.2 NEW Each pressure gauge shall measure the pressure drop in 1-inch water column increments or less. [R307-401-8] II.B.5.d NEW During operation of the asphalt drum mixer baghouse, the owner/operator shall maintain the static pressure drop across the baghouse between 2.0 and 6.0 inches of water column. During operation of the storage silo baghouses, the owner/operator shall maintain the static pressure drop within the range recommended by the manufacturer for normal operations. [R307-401-8] II.B.5.d.1 NEW The owner/operator shall record the pressure drop at least once per operating day while each baghouse is operating. [R307-401-8] II.B.5.d.2 NEW The owner/operator shall maintain the following records of the pressure drop readings: A. Unit identification; B. Manufacturer recommended static pressure drop for the unit (if applicable); C. Date of reading; D. Daily static pressure drop readings. [R307-401-8] II.B.5.e NEW At least once every 12 months, the owner/operator shall calibrate the pressure gauges in accordance with the manufacturer's instructions or replace the gauges. [R307-401-8] II.B.5.e.1 NEW The owner/operator shall maintain records of the pressure gauge calibrations and replacements. [R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 18 II.B.5.f NEW The owner/operator shall install a baghouse on each lime, fly ash, and asphalt storage silo with a control efficiency of no less than 98%. [R307-401-8] II.B.5.f.1 NEW To demonstrate compliance with the above condition, the owner/operator shall maintain records of the manufacturer's control efficiency guarantee for the installed baghouse. [R307- 401-8] II.B.5.g The owner/operator shall use a baghouse to control process streams from the asphalt plant drum. The baghouse shall be sized to handle at least 69,000 ACFM. All exhaust air from the drum shall be routed through the baghouse before being vented to the atmosphere. [R307-401- 8] II.B.5.h NEW The owner/operator shall not emit more than the following rates and concentrations from the Asphalt Plant Baghouse: Pollutant grains/dscf Filterable PM10 0.024 Filterable PM2.5 0.024 [R307-801-8] II.B.5.h.1 NEW Compliance Demonstration To demonstrate compliance with the emission limitations above, the owner/operator shall perform stack testing on the emissions unit according to the stack testing conditions contained in this AO. The owner/operator shall test for condensable PM; however, the condensable particulate emissions shall not be used for compliance demonstration, but shall be used for inventory purposes. [R307-165-2, R307-401-8] II.B.5.h.2 NEW Initial Test The owner/operator shall conduct an initial stack test on the emission unit within 180 days after startup of the emission unit. [R307-165-2] II.B.5.h.3 NEW Test Frequency The owner/operator shall conduct a stack test on the emission unit within three (3) years after the date of the most recent stack test of the emission unit. The Director may require the owner/operator to perform a stack test at any time. [R307-165-2, R307-401-8] II.B.6 NEW Stack Testing Requirements II.B.6.a NEW The owner/operator shall conduct any stack testing required by this AO according to the following conditions. [R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 19 II.B.6.a.1 NEW Notification At least 30 days prior to conducting a stack test, the owner/operator shall submit a source test protocol to the Director. The source test protocol shall include the items contained in R307-165-3. If directed by the Director, the owner/operator shall attend a pretest conference. [R307-165-3, R307-401-8] II.B.6.a.2 NEW Testing & Test Conditions The owner/operator shall conduct testing according to the approved source test protocol and according to the test conditions contained in R307-165-4. [R307-165-4, R307-401-8] II.B.6.a.3 NEW Access The owner/operator shall provide Occupational Safety and Health Administration (OSHA)- or Mine Safety and Health Administration (MSHA)-approved access to the test location. [R307-401-8] II.B.6.a.4 NEW Reporting No later than 60 days after completing a stack test, the owner/operator shall submit a written report of the results from the stack testing to the Director. The report shall include validated results and supporting information. [R307-165-5, R307-401-8] II.B.6.a.5 NEW Possible Rejection of Test Results The Director may reject stack testing results if the test did not follow the approved source test protocol or for a reason specified in R307-165-6. [R307-165-6, R307-401-8] II.B.6.b NEW Test Methods When performing stack testing, the owner/operator shall use the appropriate EPA-approved test methods as acceptable to the Director. Acceptable test methods for pollutants are listed below. [R307-401-8] II.B.6.b.1 NEW Standard Conditions A. Temperature - 68 degrees Fahrenheit (293 K) B. Pressure - 29.92 in Hg (101.3 kPa) C. Averaging Time - As specified in the applicable test method [40 CFR 60 Subpart A, 40 CFR 63 Subpart A, R307-401-8] II.B.6.b.2 NEW Filterable PM10 40 CFR 60, Appendix A, Method 5; 40 CFR 51, Appendix M, Method 201; Method 201A; or other EPA-approved testing method as acceptable to the Director. If other approved testing methods are used which cannot measure the PM10 fraction of the filterable particulate emissions, all of the filterable particulate emissions shall be considered PM10. [R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 20 II.B.6.b.3 NEW Filterable PM2.5 40 CFR 60, Appendix A, Method 5; 40 CFR 51, Appendix M, Method 201A or other EPA- approved testing method as acceptable to the Director. If other approved testing methods are used which cannot measure the PM2.5 fraction of the filterable particulate emissions, all of the filterable particulate emissions shall be considered PM2.5. [R307-401-8] II.B.6.b.4 NEW Condensable PM 40 CFR 51, Appendix M, Method 202 or other EPA-approved testing method as acceptable to the Director. [R307-401-8] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 21 PERMIT HISTORY When issued, the approval order shall supersede (if a modification) or will be based on the following documents: Supersedes DAQE-AN158520001-18 dated November 29, 2018 Is Derived From NOI dated February 2, 2022 Incorporates Additional Information Received dated March 11, 2022 Incorporates Additional Information Received dated April 4, 2022 Incorporates Additional Information Received dated September 1, 2022 Incorporates Modeling Memo DAQE-MN158520002-22 dated September 9, 2022 REVIEWER COMMENTS 1. Comment regarding Federal Subpart Applicability: NSPS Subpart I The hot mix asphalt plant is subject to 40 CFR 60, Subpart I (Standards of Performance for Hot Mix Asphalt Facilities). The provisions of Subpart I are applicable to a facility constructed after June 11, 1973 comprised only of any combination of: dryers; systems for screening, handling, storing, and weighing hot aggregate; systems for loading, transferring, and storing mineral filler, systems for mixing hot mix asphalt; and the loading, transfer, and storage systems associated with emission control systems. Subpart I applies to this facility. NSPS Subpart OOO The Benjamin Pit is subject to 40 CFR 60, Subpart OOO (Standards of Performance for Nonmetallic Mineral Processing Plants). The provisions of OOO are applicable to fixed above ground nonmetallic mineral processing plants, including; crusher, grinding mill, screening operation, bucket elevator, belt conveyor, bagging operation, storage bin, enclosed truck or railcar loading stations. This site operates a nonmetallic aggregate crushing, storage, and transfer processes. Therefore, Subpart OOO applies to this facility. NSPS Subpart Kb 40 CFR 60, Subpart Kb (Standards of Performance for Volatile Organic Liquid Storage Vessels (Including Petroleum Liquid Storage Vessels) for Which Construction, Reconstruction, or Modification Commenced After July 23, 1984) does not apply to storage tanks with a storage capacity greater than 75m3 (19,813 gallons) to 151 m3 (39,890 gallons) with a vapor pressure less than 15 kPa. Storage tanks on site do not store any liquid with a vapor pressure greater than 15 kPa. This subpart does not apply to any on-site storage tanks. [Last updated October 31, 2022] 2. Comment regarding Title V Applicability: Title V of the 1990 Clean Air Act (Title V) applies to the following: 1. Any major source 2. Any source subject to a standard, limitation, or other requirement under Section 111 of the Act, Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 22 Standards of Performance for New Stationary Sources; 3. Any source subject to a standard or other requirement under Section 112 of the Act, Hazardous Air Pollutants. 4. Any Title IV affected source. This facility is not a major source and is not a Title IV source. The facility is not subject to 40 CFR 61 (NESHAP) or 40 CFR 63 (MACT) regulations. This facility is subject to 40 CFR 60 (NSPS) Subparts A, I, and OOO. NSPS Subparts I and OOO do not specifically exempt the facility from the obligation to obtain a Title V permit; therefore, Title V applies to this facility as an area source. There is no requirement for this source to apply for an initial Title V operating permit under current UDAQ and EPA rules. The source will be charged applicable Title V fees and Title V funds may be used for inventory and compliance inspections of this source. [Last updated September 15, 2022] 3. Comment regarding Emission Estimates: Emission estimates were based off of plant operations of 24 hours per day for seven days a week over a 12-month period with a total of 800,000 tons/year of aggregate processing (an increase of 200,000 tpy). Blasting emissions were estimated assuming a maximum blasting area of 185, 856 square feet per rolling 12-month period. The blasting SO2 emission factor was obtained from AP-42 Section 13.3 for Explosives Detonation. The SO2 emissions are based on a diesel sulfur content of 15 ppm, assuming complete conversion to SO2. Particulate emission factors were based on AP-42 11.9 for Western Surface Coal Mining. Drilling emission factors for particulate matter were also retrieved from AP-42 Section 11.9. The NOx emission factor is the average of measurements from "NOX Emissions from Blasting Operations in Open-Cut Coal Mining" by Moetaz I. Attalla, Stuart J. Day, Tony Lange, William Lilley, and Scott Morgan (2008). The CP emission factor is the average of measurements in "Factors Affecting ANFO Fumes Production" by James H.Rowland III and Richard Mainiero (2001). Crushing, Screening and Transfer point emissions for PM10 and PM2.5 were calculated using emission factors from AP-42 Section 11.19.2 in Table 11.19.2-2 for Crushed Stone Processing and Pulverized Mineral Material. Wet suppression was assumed as a control factor in the calculation with inherent moisture at 4%. Storage pile increased by 6 acres to a total of 18 acres. Emissions were based on emission factors for PM10 listed in AP-42 Section 8.19.1 Table -1: Storage Piles. PM10 and PM2.5 emissions for loading and unloading of the storage piles was estimated with Equation 1 from Section 13.2.4.3. Wind Erosion PM10 and PM2.5 emissions of the disturbed area were estimated with using Table 11.9-4. Haul road PM10 and PM2.5 emissions were calculated using emission factors from AP-42 Section 13.2.2 for Unpaved and Paved Roads. A control percentage of 85% was assumed for chemical suppression and watering on unpaved roads. A control percentage of 95% was assumed for vacuum sweeping, and water application on paved roads. Dozing operation PM10 and PM2.5 emissions were estimated through AP-42 Section 11.9: Western Surface Mining Tables -1 and -3. Overburden moisture and silt contents from AP-42 were used. The Hot Mix Asphalt plant emissions were estimated for: drum mix, hot oil heater, silo loading, asphalt load out, asphalt transport, and fuel storage Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 23 Emission estimates from the HMA drum mix plant were based on 250,000 tons per year of asphalt production with a maximum rate of 400 tph. Emissions were based on emission factors from AP-42 Section 11.1 for Hot Asphalt Mix Plants. Particulate emissions form the drum mix plant were based on Tables 11.1-3 and 11.1-4 for a fabric filter controlled dryer. CO, SO2, and NOx emissions for a waste oil-fired dryer were estimated from the emission factors in Table 11.1-7. VOC emissions were based on Table 11.1-8. It was assumed that low NOx control resulted in a 45% reduction as per AP- 42 1.3; Fuel Oil Combustion . HAP emissions were based on the emission factors in Table 11.1-10 and 11.1-1 The emissions from the Hot Oil heater were based on AP-42 Section 1.3 for Fuel Oil Combustion. Silo Loading, asphalt plant load out were estimated based on AP-42 Section 11.1 Table 11.1-14 for PM, VOC, and CO, Table 11.1-15 and -16 for HAPs. Fuel storage tanks were based on the emission factors for VOC from AP-42 7.1: Organic Liquid Storage Tanks CO2e emissions were calculated through global warming potentials in 40 CFR 98 Subpart A Table A-1, C-2 and C-3. [Last updated October 31, 2022] Engineer Review N158520002: Kilgore Contracting, LLC- Benjamin Aggregate & Asphalt Plant November 3, 2022 Page 24 ACRONYMS The following lists commonly used acronyms and associated translations as they apply to this document: 40 CFR Title 40 of the Code of Federal Regulations AO Approval Order BACT Best Available Control Technology CAA Clean Air Act CAAA Clean Air Act Amendments CDS Classification Data System (used by EPA to classify sources by size/type) CEM Continuous emissions monitor CEMS Continuous emissions monitoring system CFR Code of Federal Regulations CMS Continuous monitoring system CO Carbon monoxide CO2 Carbon Dioxide CO2e Carbon Dioxide Equivalent - 40 CFR Part 98, Subpart A, Table A-1 COM Continuous opacity monitor DAQ/UDAQ Division of Air Quality DAQE This is a document tracking code for internal UDAQ use EPA Environmental Protection Agency FDCP Fugitive dust control plan GHG Greenhouse Gas(es) - 40 CFR 52.21 (b)(49)(i) GWP Global Warming Potential - 40 CFR Part 86.1818-12(a) HAP or HAPs Hazardous air pollutant(s) ITA Intent to Approve LB/HR Pounds per hour LB/YR Pounds per year MACT Maximum Achievable Control Technology MMBTU Million British Thermal Units NAA Nonattainment Area NAAQS National Ambient Air Quality Standards NESHAP National Emission Standards for Hazardous Air Pollutants NOI Notice of Intent NOx Oxides of nitrogen NSPS New Source Performance Standard NSR New Source Review PM10 Particulate matter less than 10 microns in size PM2.5 Particulate matter less than 2.5 microns in size PSD Prevention of Significant Deterioration PTE Potential to Emit R307 Rules Series 307 R307-401 Rules Series 307 - Section 401 SO2 Sulfur dioxide Title IV Title IV of the Clean Air Act Title V Title V of the Clean Air Act TPY Tons per year UAC Utah Administrative Code VOC Volatile organic compounds Process PM10 PM2.5 NOx CO SO2 Aggregrate Processing 1.29 0.24 Stockpiles + Disturbed Grounds 6.04 3.46 Bulldozing + Drops 1.37 0.29 Roads 6.92 0.69 Tanks Silos 0.14 0.14 0.00 0.36 0.00 Hot Oil Heater 0.03 0.02 0.55 0.05 0.00 Drilling and Blasting 0.11 0.01 0.11 2.56 0.00 Drum-Mix Dryer 2.88 2.77 3.78 16.25 7.25 Total 18.784 7.6221 4.44 19.22 7.252 Aggregrate Processing 0.25 0.06 Stockpiles + Disturbed Grounds 2.07 1.22 Bulldozing + Drops 0.28 0.04 Roads 1.92 0.19 Tanks Silos 0.02 0.02 0.06 Hot Oil Heater 0.03 0.02 0.55 0.05 0.00236 Drilling and Blasting 0.03 0.00154 0.03 0.67 0.000059 Drum-Mix Dryer 0.46 0.46 0.61 2.6 1.16 Total 18.77 7.72 4.44 19.22 7.25 Permitted Emission 12.8 5.43 6.41 16.29 4.95 Increase 5.97 2.29 -1.97 2.93 2.3 Increase After Using New Emission Factors 5.06 2.01154 1.19 3.38 1.162419 VOC FACILITY WIDE TOTAL 0.06 2.15 0.00 0 4.00 6.213 FACILIY WIDE INCREASE 0.04 0.34 0.64 6.21 5.17 1.04 1.02 HAPS increase 1.35 total 2.5 Drum Mix Acetalehe 1.63E-01 Hot Oil Heater Acrolein 3.25E-03 Benzene 4.88E-02 Ethylbenzen 3.00E-02 Formaldehyde 3.88E-01 Hexane 1.15E-01 Isooctane 5.00E-03 Methyl 2.50E-03 Propionaldehyd 1.63E-02 Quinone 2.00E-02 Methyl 6.00E-03 Toluene 3.63E-01 Xylene 2.50E-02 2-Methylnaphth 2.13E-02 Acenaphthene 1.75E-04 Acenaphthylene 2.75E-03 Anthracene 3.88E-04 Benzo(a)anthra 2.63E-05 Benzo(a)pyrene 1.23E-06 Benzo(b)fluoran 1.25E-05 Benzo(e)pyrene 1.38E-05 Benzo(g,h,i)per 5.00E-06 Benzo(k)fluoran 5.13E-06 Chrysene 2.25E-05 Fluoranthene 7.63E-05 Fluorene 1.38E-03 Indeno(1,2,3-cd 8.75E-07 Naphthalene 8.13E-02 Perylene 1.10E-06 Phenanthrene 2.88E-03 Pyrene 3.75E-04 Dioxins 3.60E-07 Furans 4.13E-07 Arsenic 7.00E-05 Beryllium 0.00E+00 Cadmium 5.13E-05 Chromium 6.88E-04 Hexavalent 5.63E-05 Cobalt 3.25E-06 Lead 1.88E-03 Manganese 9.63E-04 Mercury 3.25E-04 Nickel 7.88E-03 Selenium 4.38E-05 Total 1.31E+00 Benzene 2.14E-06 Asphalt Operations 1,4-Dichlorobenzene(p)0.00E+00 Ethylbenzene 6.36E-07 Formaldehyde 3.30E-04 Hexane 0.00E+00 Methyl Trichloroethane)2.36E-06 Naphthalene 1.13E-05 POM 6.06E-07 Toluene 6.20E-05 Xylene 1.09E-06 Antimony 5.25E-05 Arsenic 1.32E-05 Beryllium 2.78E-07 Cadmium 3.98E-06 Chromium 8.45E-06 Chromium 2.48E-06 Cobalt 6.02E-05 Lead 1.51E-05 Manganese 3.00E-05 Mercury 1.13E-06 Nickel 8.45E-04 Phosphorus 9.46E-05 Selenium 6.83E-06 Total 1.54E-03 TOTAL HAPS 1.35E+00 CURRENTLY PERMITTED 1.15 2.03E-01 Asphalt Silo LoaAsphalt Loadou Asphalt TranspoLime Silo Loadi Lime Silo Loading, Pneumatic Benzene 4.87E-04 2.70E-04 2.70E-04 0.00E+00 0.00E+00 Bromomethane 7.46E-05 4.99E-05 4.99E-05 0.00E+00 0.00E+00 Carbon Disulfid 2.44E-04 6.76E-05 6.76E-05 0.00E+00 0.00E+00 Chloroethane 6.09E-05 1.09E-06 1.09E-06 0.00E+00 0.00E+00 Chloromethane 3.50E-04 7.80E-05 7.80E-05 0.00E+00 0.00E+00 Cumene 0.00E+00 5.72E-04 5.72E-04 0.00E+00 0.00E+00 Ethylbenzene 5.79E-04 1.46E-03 1.46E-03 0.00E+00 0.00E+00 Formaldehyde 1.05E-02 4.57E-04 4.57E-04 0.00E+00 0.00E+00 Hexane 1.52E-03 7.80E-04 7.80E-04 0.00E+00 0.00E+00 Isooctane 4.72E-06 9.36E-06 9.36E-06 0.00E+00 0.00E+00 Methylene Chlo 4.11E-06 0.00E+00 0.00E+00 0.00E+00 0.00E+00 Naphthalene 5.78E-04 5.33E-04 5.33E-04 0.00E+00 0.00E+00 Phenol 0.00E+00 5.03E-04 5.03E-04 0.00E+00 0.00E+00 POM 3.04E-03 1.99E-03 1.99E-03 0.00E+00 0.00E+00 Styrene 8.23E-05 3.80E-05 3.80E-05 0.00E+00 0.00E+00 Tetrachloroethy 0.00E+00 4.00E-05 4.00E-05 0.00E+00 0.00E+00 Toluene 9.44E-04 1.09E-03 1.09E-03 0.00E+00 0.00E+00 Xylene 3.91E-03 2.55E-03 2.55E-03 0.00E+00 0.00E+00 Arsenic 0.00E+00 0.00E+00 0.00E+00 1.56E-09 1.84E-07 Beryllium 0.00E+00 0.00E+00 0.00E+00 1.79E-10 1.66E-08 Cadmium 0.00E+00 0.00E+00 0.00E+00 1.72E-09 3.65E-09 Chromium 0.00E+00 0.00E+00 0.00E+00 1.07E-08 2.24E-07 Lead 0.00E+00 0.00E+00 0.00E+00 4.01E-09 9.56E-08 Manganese 0.00E+00 0.00E+00 0.00E+00 4.30E-08 4.70E-08 Nickel 0.00E+00 0.00E+00 0.00E+00 1.54E-08 4.19E-07 Phosphorus 0.00E+00 0.00E+00 0.00E+00 8.67E-08 6.50E-07 Selenium 0.00E+00 0.00E+00 0.00E+00 0.00E+00 1.33E-08 Total 2.24E-02 1.05E-02 1.05E-02 1.63E-07 1.65E-06 Total 4.34E-02 Production Rates Hourly Rates 400 tons/hour Annual Production 800,000 tons/year On NOI: Emission Unit Number of Emission Units PM10 Emission Factor (lb/ton) PM2.5 Emission Factor (lb/ton)Reference Pollutant Emission Total (tons/year) Crushers 3 0.00030 0.00005 PM10 1.29 Screens 3 0.00037 0.00005 PM2.5 0.24 Conveyor Transfer Points 31 4.6E-05 1.3E-05 Difference Pollutant Emission Rate (lbs/hr) Emission Total (tons/year)Pollutant Emission Total (tons/year)PM10 1.37 1.37 PM10 -0.08 PM2.5 0.28 0.28 PM2.5 -0.04 Difference <0.2 tpy Emission Unit PM10 Emission Rate (lbs/hr) PM10 Emission Total (tons/year) PM2.5 Emission Rate (lbs/hr) PM2.5 Emission Total (tons/year) Crushers 0.36 0.36 0.06 0.06 Screens 0.44 0.44 0.06 0.06 Conveyors 0.57 0.57 0.16 0.16 Aggregate Processing Equipment AP-42 Table 11.19.2-2 Page 10 of Version 1.0 November 29, 2018 Size PM 10-6 PM 6-2.5 PM <2.5 Reference Storage Pile Area *Increasing by 6, wet suppression particle size 51%34%15%AP-42 Appendix B.2 Table B.2-2 Total Area of Storage Piles 6 acres EF < size 6.3 4.2 1.852941 AP-42 Fourth Edition Table 8.19.1-1 EF for range 2.1 2.347059 1.852941 Control Efficiency Control 90%65%40%AP-42 Appendix B.2 Table B.2-3, Row 061PM10 Control Efficiency 70%Controlled EF for range 0.2100 0.8215 1.1118 PM2.5 Control Efficiency 40%Controlled EF for < PM10 2.143 Total Control Efficiency 66.0%54.0%40.0% Pollutant Uncontrolled Emission Factor (lb/acre-day) Controlled Emission Factor (lb/acre-day) Emission Rate (lbs/hr) Emission Total (tons/year)ReferencePM106.30 1.89 0.47 2.07 AP-42 Fourth Edition Table 8.19.1-1PM2.5 1.85 1.11 0.28 1.22 AP-42 Appendix B.2 Table B.2-2 Wind Erosion of Exposed Area Total Area of Disturbed Ground 1 acres *Increasing by 1, wet suppression Emission Factors & Distribution TSP Emission Factor 0.38PM10 Content 50% PM2.5 Content 7.5%Total On NOI Difference Pollutant Emission Emission Emission Pollutant Emission Emission EmissionPM100.19 0.05 0.21 PM10 2.28 6.04 3.76 PM2.5 0.03 0.01 0.03 PM2.5 1.25 3.46 2.21 Difference <0.2 tpy AP-42 Table 11.9-4 AP-42 Section 13.2.5.3 Storage Piles Reference AP-42 Appendix B.2 Tables B.2-2 & B.2-3 Disturbed Ground Reference Page 11 of Version 1.0 November 29, 2018 Bulldozer Hours of Operation Hours operated per year 1,800 hours/year Variables for Bulldozing Overburden Material Silt Content 6.9 % Material Moisture Content 7.9 %Total On NOI Difference Pollutant Emission Factor (lb/hr) Emission Rate (lbs/hr) Emission Total (tons/year)Reference PM10 PM2.5 Pollutant Total (tons/yea r) Total (tons/yea r) Total (tons/yea r)PM10 0.75276 0.23 0.20 Scaling Factor 0.75 0.105 AP-42 Table 11.9-1 PM10 1.42 1.37 -0.05 PM2.5 0.41378 0.12 0.11 PM2.5 0.30 0.29 -0.01 *0.3 Difference <0.2 tpy *wet suppression = 70% PM10 PM2.5 Production Rates k (particle size multiplier)0.35 0.053 AP-42 13.2.4.3 Hourly Rates 500 tons/hour Annual Production 282,154 tons/year (average from NOI) Variables Number of Transfer Points 12 Mean Wind Speed 9 mph Moisture Content 2 % Pollutant Emission Emission Emission ReferencePM100.00240 4.33 1.22 PM2.5 0.00036 0.66 0.18 *0.3 *0.3 *wet suppression = 70% Bulldozing AP-42 11.9 Table 11.9-1 Material Handling AP-42 13.2.4.3 Equation #1 Page 12 of Version 1.0 November 29, 2018 Silt Content 4.8 surface material silt content (%) Production Rates Hourly Rates 500 tons/hour 70%Basic Watering - (70% control) Annual Production 500,000 tons/year 75%Road Base with Watering - (75% control) 85%Chemical Suppressant & Watering - (85% control) Truck Information 90%Paving with Sweeping & Watering - (90% control) Empty Truck Weight 15 tons 95%Paving with Vacuum Sweeping & Watering - (95% control) Weight of Load 35 tons Loaded Truck Weight 50 tons PM10 PM2.5 k (lb/VMT)1.5 0.15 Haul Road Information a 0.9 0.9 VMT/yr 31,000 b 0.45 0.45 Type of Control Pollutant Uncontrolled Controlled Emission Emission ReferencePM101.92 0.29 372.25 4.47 PM2.5 0.192 0.029 37.22 0.45 Production Rates Hourly Rates 500 tons/hour Annual Production 500,000 tons/year Truck Information Empty Truck Weight 15 tons Weight of Load 35 tons Loaded Truck Weight 50 tons Haul Road Information VMT/yr 17,500 Type of Control Total On NOI Difference Pollutant Uncontrolled Controlled Emission Emission Reference Pollutant Emission Emission EmissionPM101.92 0.10 70.05 0.84 PM10 6.77 6.92 0.15 PM2.5 0.192 0.01 7.00 0.08 PM2.5 0.68 0.69 0.01 Difference <0.2 tpylikely due to rounding Production Rates Hourly Rates 500 tons/hour Annual Production 700,000 tons/year Truck Information Empty Truck Weight 34 tons Weight of Load 10 tons Loaded Truck Weight 44 tons Haul Road Information VMT/yr 9,400 Type of Control Pollutant Uncontrolled Controlled Emission Emission ReferencePM102.07 0.31 121.82 1.46 PM2.5 0.207 0.03 12.18 0.15 AP-42 13.2.2 & DAQ Haul Road Guidance AP-42 13.2.2 & DAQ Haul Road Guidance Haul Roads- Unpaved (Trucks) Chemical Suppressant & Watering - (85% control) AP-42 13.2.2 & DAQ Haul Road Guidance Haul Roads - Paved (Trucks) Paving with Vacuum Sweeping & Watering - (95% control) Haul Roads - Unpaved (Loaders) Chemical Suppressant & Watering - (85% control) Page 13 of Version 1.0 November 29, 2018 Equipment Details Hourly Rating 29 tons/hour Annual Production 250,000 tons/year Plant Type Drum Mix Fuel Type Hot Oil Burner Rating 0.25 MMBtu/hour Criteria Pollutant Emission Factor (lb/ton) Emission Rate (lbs/hr) Emission Total (tons/year)Reference NOX 0.055 1.57 6.88 AP-42 Table 11.1-5 & 7 CO 3.78 16.58 PM10 0.71 3.09 PM2.5 0.67 2.93 SO2 0.058 1.66 7.25 AP-42 Table 11.1-5 & 7 VOC 0.03 6.01 See Below Lead 1.50E-05 0.00 0.00 AP-42 Table 1.3-11 HAP 0.31 1.37CO2e4,382 PM10 Sources Emission Factor (lb/ton) Emission Rate (lbs/hr) Emission Total (tons/year)Reference Dryer 0.0236 0.67 2.95 Plant Load-out 5.22E-04 0.01 0.07 Silo Filling 5.86E-04 0.02 0.07 PM2.5 Sources Emission Factor (lb/ton) Emission Rate (lbs/hr) Emission Total (tons/year)Reference Dryer 0.0223 0.64 2.79 Plant Load-out 5.22E-04 0.01 0.07 Silo Filling 5.86E-04 0.02 0.07 CO Emission Sources Emission Factor (lb/ton) Emission Rate (lbs/hr) Emission Total (tons/year)Reference Dryer 0.13 3.71 16.25 Plant Load-out 1.35E-03 0.04 0.17 Silo Filling 1.18E-03 0.03 0.15 Hot Oil System (EF = lb/MMBtu)8.57E-03 0.00 0.01 VOC Sources Emission Factor (lb/ton) Emission Rate (lbs/hr) Emission Total (tons/year)Reference Dryer 0.032 0.91 4.00 Plant Load-out 3.91E-03 0.11 0.49 Silo Filling 1.22E-02 0.35 1.52 Hot Oil System (EF = lb/MMBtu)1.89E-04 0.00 0.00 Asphalt Transport 1.10E-03 0.03 0.14 AP-42 Table 11.1-6, Table 11.1-8, Table 11.1-13, & Table 11.1-14 AP-42 Table 11.1-1 & 2, & Table 11.1-3 & 4, & Table 11.1-14 AP-42 Table 11.1-5, Table 11.1-7, Table 11.1-13, & Table 11.1-14 Hot Mix Asphalt Plants Nat Gas + Fuel Oil + Waste Oil See Below See Below AP-42 Table 11.1-1 & 2, & Table 11.1-3 & 4, & Table 11.1-14 Page 14 of Version 1.0 November 29, 2018 CO2 Sources Emission Factor (lb/ton) Emission Rate (lbs/hr) Emission Total (tons/year)Reference Dryer 33 942 4,125 Hot Oil System (EF = lb/MMBtu)2.00E+02 50 219 Methane Sources Emission Factor (lb/ton) Emission Rate (lbs/hr) Emission Total (tons/year)Reference Dryer 0.012 0.34 1.50 Plant Load-out 2.70E-04 0.01 0.03 Silo Filling 3.17E-05 0.00 0.00 GHG Sources Global Warming Potential Emission Rate (lbs/hr) Emission Total (tons/year)ReferenceCO2 (mass basis)1 992 4,344 Methane (mass basis)25 0.35 1.54CO2e4,382 Hazardous Air Pollutant Emission Factor (lb/ton) Emission Rate (lbs/hr) Emission Total (tons/year)Reference lb/yr HCl 0.00021 5.99E-03 2.63E-02 AP-42 Table 11.1-8 Acetaldehyde 1.30E-03 3.71E-02 1.63E-01 325.0 Acrolein 2.60E-05 7.42E-04 3.25E-03 Benzene 3.96E-04 1.13E-02 4.95E-02 Bromomethane 9.96E-07 2.84E-05 1.25E-04 2-Butanone 6.79E-06 1.94E-04 8.49E-04 Carbon Disulfide 2.49E-06 7.11E-05 3.11E-04 Chloroethane 4.96E-07 1.42E-05 6.20E-05 Chloromethane 3.43E-06 9.78E-05 4.28E-04 Cumene 4.57E-06 1.31E-04 5.72E-04 Ethylbenzene 2.56E-04 7.31E-03 3.20E-02 Formaldehyde 3.19E-03 9.10E-02 3.98E-01 797.0 n-Hexane 9.38E-04 2.68E-02 1.17E-01 234.6 Isooctane (2,2,4-trimethylpentane)4.01E-05 1.14E-03 5.01E-03 Methylchloroform 4.80E-05 1.37E-03 6.00E-03 Methylene Chloride 3.29E-08 9.39E-07 4.11E-06 Propionaldehyde 1.30E-04 3.71E-03 1.63E-02 Quinone 1.60E-04 4.57E-03 2.00E-02 Styrene 9.62E-07 2.74E-05 1.20E-04 Tetrachloroethene 3.20E-07 9.14E-06 4.00E-05 Toluene 2.92E-03 8.32E-02 3.65E-01 729.1 Trichlorofluoromethane 5.41E-08 1.54E-06 6.76E-06 m-/p-Xylene 4.14E-05 1.18E-03 5.18E-03 o-Xylene 1.03E-05 2.93E-04 1.28E-03 Xylene 2.00E-04 5.71E-03 2.50E-02 AP-42 Table 11.1-5, 7, Table 11.1-13, AP-42 Table 11.1-6, 8, & Table 11.1-14, 16 See Above & Table A-1 to Subpart A of Part 98 AP-42 Table 11.1-9, Table 11.1-10, Table 11.1-11, Table 11.1-12, Table 11.1-13, Table 11.1-14, Table 11.1-15, Table 11.1-16 Page 15 of Version 1.0 November 29, 2018 Hazardous Air Pollutant Emission Factor (lb/ton) Emission Rate (lbs/hr) Emission Total (tons/year)Reference 2-Methylnaphthalene 1.91E-04 5.47E-03 2.39E-02 Acenaphthene 3.48E-06 1.00E-04 4.39E-04 Acenaphthylene 2.21E-05 6.32E-04 2.77E-03 Anthracene 3.67E-06 1.05E-04 4.60E-04 Benz(a)anthracene 4.17E-07 1.19E-05 5.21E-05 Benzo(a)pyrene 1.76E-08 5.03E-07 2.21E-06 Benzo(b)fluoranthene 1.26E-07 3.77E-06 1.65E-05 Benzo(e)pyrene 1.61E-07 4.59E-06 2.01E-05 Benzo(g,h,i)perylene 4.65E-08 1.33E-06 5.81E-06 Benzo(k)fluoranthene 4.85E-08 1.38E-06 6.06E-06 Chrysene 1.06E-06 3.04E-05 1.33E-04 Dibenz(a,h)anthracene 1.26E-09 3.60E-08 1.58E-07 Fluoranthene 1.16E-06 3.32E-05 1.46E-04 Fluorene 1.62E-05 4.62E-04 2.02E-03 Indeno(1,2,3-cd)pyrene 8.60E-09 2.46E-07 1.08E-06 Naphthalene 6.59E-04 1.88E-02 8.25E-02 165.0 Perylene 1.60E-07 4.57E-06 2.00E-05 Phenanathrene 3.03E-05 8.74E-04 3.83E-03 Pyrene 4.63E-06 1.32E-04 5.79E-04 Arsenic 5.60E-07 1.60E-05 7.00E-05 Beryllium 0.00E+00 0.00E+00 0.00E+00 Cadmium 4.10E-07 1.17E-05 5.13E-05 Chromium 5.50E-06 1.57E-04 6.88E-04 Cobalt 2.60E-08 7.42E-07 3.25E-06 Hexavalent Chromium 4.50E-07 1.28E-05 5.63E-05 Lead 1.50E-05 4.28E-04 1.88E-03 Manganese 7.70E-06 2.20E-04 9.63E-04 Mercury 2.60E-06 7.42E-05 3.25E-04 Nickel 6.30E-05 1.80E-03 7.88E-03 Phosphorus 2.80E-05 7.99E-04 3.50E-03 Selenium 3.50E-07 9.99E-06 4.38E-05 Dioxins 7.90E-11 2.61E-09 1.14E-08 Furans 4.00E-11 1.20E-09 5.24E-09 Total Haps 1.37E+00 Generic Ha 2.42E-01 AP-42 Table 11.1-9, Table 11.1-10, Table 11.1-11, Table 11.1-12, Table 11.1-13, Table 11.1-14, Table 11.1-15, Table 11.1-16 Page 16 of Version 1.0 November 29, 2018 -0.5 Asphalt Volatility Heating Value of Natural Gas 325 Temperature (°F)1020 BTU/scf or MMBtu/MMsc Heating Value of #2 & Distillate 140 MMBtu/1,000 gal Table 11.1-1 & 2 Dryer Emissions Table 11.1-3 & 4 Fabric Filter Control Type lb/ton lb/hr Ton/year Reference Inorganic Cond.Batch 0.013 0.37 1.63 Table 11.1-1 Organic Cond.Batch 0.0041 0.12 0.51 Table 11.1-1 Filterable PM10 Batch 0.0098 0.28 1.23 Table 11.1-2 Filterable PM2.5 Batch 0.0083 0.24 1.04 Table 11.1-2 Inorganic Cond.Drum 0.0074 0.21 0.93 Table 11.1-3 Organic Cond.Drum 0.012 0.34 1.50 Table 11.1-3 Filterable PM10 Drum 0.0042 0.12 0.53 Table 11.1-4 Filterable PM2.5 Drum 0.0029 0.08 0.36 Table 11.1-4 Dryer Emissions EF Pollutant Type Fuel lb/ton lb/hr Ton/year Check Reference CO Batch Nat Gas 0.4 11.42 50.00 Table 11.1-5 CO Batch Fuel Oil 0.4 11.42 50.00 Table 11.1-5 CO Batch Waste Oil 0.4 11.42 50.00 Table 11.1-5 CO Drum Nat Gas 0.13 3.71 16.25 Match Table 11.1-7 CO Drum Fuel Oil 0.13 3.71 16.25 Match Table 11.1-7 CO Drum Waste Oil 0.13 3.71 16.25 Match Table 11.1-7 CO2 Batch Nat Gas 37 1,056 4,625 Table 11.1-5 CO2 Batch Fuel Oil 37 1,056 4,625 Table 11.1-5 CO2 Batch Waste Oil 37 1,056 4,625 Table 11.1-5 CO2 Drum Nat Gas 33 942 4,125 Match Table 11.1-7 CO2 Drum Fuel Oil 33 942 4,125 Match Table 11.1-7 CO2 Drum Waste Oil 33 942 4,125 Match Table 11.1-7 Nox Batch Nat Gas 0.025 0.71 3.13 Table 11.1-5 Nox Batch Fuel Oil 0.12 3.42 15.00 Table 11.1-5 Nox Batch Waste Oil 0.12 3.42 15.00 Table 11.1-5 Nox Drum Nat Gas 0.026 0.74 3.25 Table 11.1-7 Nox Drum Fuel Oil 0.055 1.57 6.88 Match Table 11.1-7 Nox Drum Waste Oil 0.055 1.57 6.88 Match Table 11.1-7 SO2 Batch Nat Gas 0.0046 0.13 0.58 Table 11.1-5 SO2 Batch Fuel Oil 0.088 2.51 11.00 Table 11.1-5 SO2 Batch Waste Oil 0.088 2.51 11.00 Table 11.1-5 SO2 Drum Nat Gas 0.0034 0.10 0.43 Table 11.1-7 SO2 Drum Fuel Oil 0.011 0.31 1.38 Table 11.1-7 Page 17 of Version 1.0 November 29, 2018 SO2 Drum Waste Oil 0.058 1.66 7.25 Match Table 11.1-7 Dryer Emissions EF Pollutant Type Fuel lb/ton lb/hr Ton/year Check Reference Methane Batch Nat Gas 0.0074 0.21 0.93 Table 11.1-6 Methane Batch Fuel Oil 0.0074 0.21 0.93 Table 11.1-6 Methane Batch Waste Oil 0.0074 0.21 0.93 Table 11.1-6 Methane Drum Nat Gas 0.012 0.34 1.50 Match Table 11.1-8 Methane Drum Fuel Oil 0.012 0.34 1.50 Match Table 11.1-8 Methane Drum Waste Oil 0.012 0.34 1.50 Match Table 11.1-8VOCBatchNat Gas 0.0082 0.23 1.03 Table 11.1-6 VOC Batch Fuel Oil 0.0082 0.23 1.03 Table 11.1-6VOCBatchWaste Oil 0.036 1.03 4.50 Table 11.1-6 VOC Drum Nat Gas 0.032 0.91 4.00 Match Table 11.1-8 VOC Drum Fuel Oil 0.032 0.91 4.00 Match Table 11.1-8 VOC Drum Waste Oil 0.032 0.91 4.00 Match Table 11.1-8 Dryer Emissions EF Pollutant Type Fuel lb/ton lb/hr Ton/year Check Reference HCl Drum Waste Oil 0.00021 0.01 0.03 Table 11.1-8 HAP Nat Gas Fuel Oil Waste Oil Nat Gas Fuel Oil Waste Oil % Org PM Acetaldehyde 0.00032 0.00032 0.00032 0.0013 Acrolein 2.6E-05 Benzene 0.00028 0.00028 0.00028 0.00039 0.00039 0.00039 0.052% Bromomethane 0.0096% 2-Butanone 0.049% Carbon Disulfide 0.013% Chloroethane 0.00021% Chloromethane 0.015% Cumene 0.11% Ethylbenzene 0.0022 0.0022 0.0022 0.00024 0.00024 0.00024 0.28% Formaldehyde 0.00074 0.00074 0.00074 0.0031 0.0031 0.0031 0.088% n-Hexane 0.00092 0.00092 0.00092 0.15% Isooctane (2,2,4-trimethylpentane)4.0E-05 4.0E-05 4.0E-05 0.0018% Methylchloroform 4.8E-05 4.8E-05 4.80E-05 Methylene Chloride Propionaldehyde 0.00013 Quinone 0.00027 0.00027 0.00027 0.00016 Styrene 0.0073% Tetrachloroethene 0.0077% Toluene 0.0010 0.0010 0.0010 0.00015 0.0029 0.0029 0.21% Plant Lo Mixer - HAP Emission Factors (lb/ton) Batch Mix (11.1-9 & 11)Drum Mix (11.1-10 & 12) Page 18 of Version 1.0 November 29, 2018 Trichlorofluoromethane 0.0013% m-/p-Xylene 0.41% o-Xylene 0.08% Xylene 0.0027 0.0027 0.0027 0.00020 0.00020 0.00020 2-Methylnaphthalene 7.1E-05 7.1E-05 7.1E-05 7.4E-05 0.00017 0.00017 2.38% Acenaphthene 9.0E-07 9.0E-07 9.0E-07 1.4E-06 1.4E-06 1.4E-06 0.26% Acenaphthylene 5.8E-07 5.8E-07 5.8E-07 8.6E-06 2.2E-05 2.2E-05 0.028% Anthracene 2.1E-07 2.1E-07 2.1E-07 2.2E-07 3.1E-06 3.1E-06 0.070% Benz(a)anthracene 4.6E-09 4.6E-09 4.6E-09 2.1E-07 2.1E-07 2.1E-07 0.019% Benzo(a)pyrene 3.1E-10 3.1E-10 3.1E-10 9.8E-09 9.8E-09 9.8E-09 0.0023% Benzo(b)fluoranthene 9.4E-09 9.4E-09 9.4E-09 1.0E-07 1.0E-07 1.0E-07 0.0076% Benzo(e)pyrene 1.1E-07 1.1E-07 1.1E-07 0.0078% Benzo(g,h,i)perylene 5.0E-10 5.0E-10 5.0E-10 4.0E-08 4.0E-08 4.0E-08 0.0019% Benzo(k)fluoranthene 1.3E-08 1.3E-08 1.3E-08 4.1E-08 4.1E-08 4.1E-08 0.0022% Chrysene 3.8E-09 3.8E-09 3.8E-09 1.8E-07 1.8E-07 1.8E-07 0.103% Dibenz(a,h)anthracene 9.5E-11 9.5E-11 9.5E-11 0.00037% Fluoranthene 1.6E-07 1.6E-07 2.4E-05 6.1E-07 6.1E-07 6.1E-07 0.050% Fluorene 1.6E-06 1.6E-06 1.6E-06 3.8E-06 1.1E-05 1.1E-05 0.77% Indeno(1,2,3-cd)pyrene 3.0E-10 3.0E-10 3.0E-10 7.0E-09 7.0E-09 7.0E-09 0.00047% Naphthalene 3.6E-05 3.6E-05 3.6E-05 9.0E-05 0.00065 0.00065 1.25% Perylene 8.8E-09 8.8E-09 8.8E-09 0.022% Phenanathrene 2.6E-06 2.6E-06 3.7E-05 7.6E-06 2.3E-05 2.3E-05 0.81% Pyrene 6.2E-08 6.2E-08 5.5E-05 5.4E-07 3.0E-06 3.0E-06 0.15% Arsenic 4.6E-07 4.6E-07 4.6E-07 5.6E-07 5.6E-07 5.6E-07 Beryllium 4.5E-07 4.5E-07 4.5E-07 Cadmium 6.1E-07 6.1E-07 6.1E-07 4.1E-07 4.1E-07 4.1E-07 Chromium 5.7E-07 5.7E-07 5.7E-07 5.5E-06 5.5E-06 5.5E-06 Cobalt 2.6E-08 2.6E-08 2.6E-08 Hexavalent Chromium 4.8E-08 4.8E-08 4.8E-08 4.5E-07 4.5E-07 4.5E-07 Lead 8.9E-07 8.9E-07 8.9E-07 6.2E-07 1.5E-05 1.5E-05 Manganese 6.9E-06 6.9E-06 6.9E-06 7.7E-06 7.7E-06 7.7E-06 Mercury 4.1E-07 4.1E-07 4.1E-07 2.4E-07 2.6E-06 2.6E-06 Nickel 3.0E-06 3.0E-06 3.0E-06 6.3E-05 6.3E-05 6.3E-05 Phosphorus 2.8E-05 2.8E-05 2.8E-05 Selenium 4.9E-07 4.9E-07 4.9E-07 3.5E-07 3.5E-07 3.5E-07 Dioxins 7.9E-11 Furans 4.0E-11 Page 19 of Version 1.0 November 29, 2018 Dryer Type EF lb/hr Ton/year Check Total PM10 Batch 0.0269 0.77 3.36 Total PM2.5 Batch 0.0254 0.72 3.18 Total PM10 Drum 0.0236 0.67 2.95 Match Total PM2.5 Drum 0.0223 0.64 2.79 Match Table 11.1-14 Process Pollutant EF lb/hr Ton/year Check Plant Load Out PM total 5.22E-04 0.01 0.07 Match Silo Filling PM total 5.86E-04 0.02 0.07 Match Table 11.1-13 Hot Oil Systems Fuel EF Units lb/MMBtu lb/hr Ton/year Check CO Nat Gas 8.90E-06 lb/ft3 8.73E-03 0.00 0.01 CO Fuel Oil 0.0012 lb/gal 8.57E-03 0.00 0.01 Match Table 11.1-14ProcessPollutantEFlb/hr Ton/year Check Reference Plant Load Out CO 1.35E-03 0.04 0.17 Match Table 11.1-14 Silo Filling CO 1.18E-03 0.03 0.15 Match Table 11.1-14 Table 11.1-13 Hot Oil Systems Fuel EF Units lb/MMBtu lb/hr Ton/year Check CO2 Nat Gas 0.2 lb/ft3 1.96E+02 49 215 CO2 Fuel Oil 28 lb/gal 2.00E+02 50 219 Match Table 11.1-13 Hot Oil Systems Fuel EF Units lb/MMBtu lb/hr Ton/year Check Formaldehyde Nat Gas 2.60E-08 lb/ft3 2.55E-05 6.37E-06 2.79E-05 Formaldehyde Fuel Oil 3.5E-06 lb/gal 2.50E-05 6.25E-06 2.74E-05 Acenaphthene Fuel Oil 5.3E-07 lb/gal 3.79E-06 9.46E-07 4.15E-06 Acenaphthylene Fuel Oil 2.0E-07 lb/gal 1.43E-06 3.57E-07 1.56E-06 Anthracene Fuel Oil 1.8E-07 lb/gal 1.29E-06 3.21E-07 1.41E-06 Benzo(b)fluoranthene Fuel Oil 1.0E-07 lb/gal 7.14E-07 1.79E-07 7.82E-07 Fluoranthene Fuel Oil 4.4E-08 lb/gal 3.14E-07 7.86E-08 3.44E-07 Fluorene Fuel Oil 3.2E-08 lb/gal 2.29E-07 5.71E-08 2.50E-07 Naphthalene Fuel Oil 1.7E-05 lb/gal 1.21E-04 3.04E-05 1.33E-04 Phenanthrene Fuel Oil 4.9E-06 lb/gal 3.50E-05 8.75E-06 3.83E-05 Pyrene Fuel Oil 3.2E-08 lb/gal 2.29E-07 5.71E-08 2.50E-07 Total PCDD/PCDF Fuel Oil 2.3E-10 lb/gal 1.64E-09 4.11E-10 1.80E-09 Plant Loadout S Page 20 of Version 1.0 November 29, 2018 Table 11.1-14 Table 11.1-16 (lb/ton) Process Pollutant % TOC EF lb/hr Ton/year Check Reference Plant Load Out TOC 4.16E-03 0.12 0.52 Table 11.1- Silo Filling TOC 1.22E-02 0.35 1.52 Table 11.1- Plant Load Out VOC 94%3.91E-03 0.11 0.49 Match Table 11.1- Silo Filling VOC 100%1.22E-02 0.35 1.52 Match Table 11.1- Plant Load Out Methane 6.5%2.70E-04 0.01 0.03 Match Table 11.1- Silo Filling Methane 0.26%3.17E-05 0.00 0.00 Match Table 11.1- VOC from Hot Oil Systems = 100% of HAP emitted from Hot Oil Systems. Table 11.1-14Table 11.1-16 EF (sum) Hot Oil Systems Pollutant lb/MMBtu lb/hr Ton/year Check Reference Nat Gas VOC 2.55E-05 6.37E-06 2.79E-05 Table 11.1-13 Fuel Oil VOC 1.89E-04 4.74E-05 2.07E-04 Match Table 11.1-13 Table 11.1-14 Process Pollutant EF (lb/ton)lb/hr Ton/year Check Plant Load Out Organic PM 3.41E-04 0.01 0.04 Subset of total PM Silo Filling Organic PM 2.54E-04 0.01 0.03 Subset of total PM lb/ton % Org PM lb/ton lb/ft3 lb/MMBtu lb/hr tons/year lb/gal lb/MMBtu 2.16E-06 0.032%3.90E-06 3.99E-07 0.0049%5.97E-07 2.04E-06 0.039%4.75E-06 5.41E-07 0.016%1.95E-06 8.73E-09 0.0040%4.87E-07 6.24E-07 0.023%2.80E-06 4.57E-06 1.16E-05 0.038%4.63E-06 3.66E-06 0.69%8.41E-05 2.6E-08 2.55E-05 6.4E-06 2.79E-05 3.5E-06 2.50E-05 6.24E-06 0.10%1.22E-05 7.49E-08 0.00031%3.78E-08 0.00027%3.29E-08 3.04E-07 0.00540%6.58E-07 3.20E-07 8.73E-06 0.062%7.56E-06 adout Silo Filling Nat Gas Fuel Hot Oil Systems (Table 11.1-13) Silo Fill Plant L Page 21 of Version 1.0 November 29, 2018 5.41E-08 1.71E-05 0.2%2.44E-05 3.33E-06 0.057%6.95E-06 8.11E-06 5.27%1.34E-05 8.86E-07 0.47%1.19E-06 5.3E-07 3.79E-06 9.55E-08 0.014%3.55E-08 2.0E-07 1.43E-06 2.39E-07 0.130%3.30E-07 1.8E-07 1.29E-06 6.48E-08 0.056%1.42E-07 7.84E-09 2.59E-08 1.0E-07 7.14E-07 2.66E-08 0.0095%2.41E-08 6.48E-09 7.50E-09 3.51E-07 0.21%5.33E-07 1.26E-09 1.70E-07 0.15%3.81E-07 4.4E-08 3.14E-07 2.63E-06 1.01%2.56E-06 3.2E-08 2.29E-07 1.60E-09 4.26E-06 1.82%4.62E-06 1.7E-05 1.21E-04 7.50E-08 0.030%7.62E-08 2.76E-06 1.80%4.57E-06 4.9E-06 3.50E-05 5.11E-07 0.44%1.12E-06 3.2E-08 2.29E-07 2.0E-10 1.43E-09 3.1E-11 2.21E-10 Page 22 of Version 1.0 November 29, 2018 Plant Loadout Silo Filling Page 23 of Version 1.0 November 29, 2018 e -14 -14 -16 -16 -16 -16 lb/hr tons/year 6.3E-06 2.74E-05 l Oil Plant Loadout Silo Filling ling Loadout Page 24 of Version 1.0 November 29, 2018 9.5E-07 4.15E-06 3.6E-07 1.56E-06 3.2E-07 1.41E-06 1.8E-07 7.82E-07 7.9E-08 3.44E-07 5.7E-08 2.50E-07 3.0E-05 1.33E-04 8.8E-06 3.83E-05 5.7E-08 2.50E-07 3.6E-10 1.56E-09 5.5E-11 2.42E-10 Page 25 of Version 1.0 November 29, 2018 Page 26 of Version 1.0 November 29, 2018 Page 27 of Version 1.0 November 29, 2018 Total On NOI Difference Criteria Emission Emission Emission Criteria NOX 0.00 0.00 0.00 NOX CO 0.32 0.36 0.04 COPM100.14 0.14 0.00 PM10PM2.5 0.14 0.14 0.00 PM2.5SO20.00 0.00 0.00 SO2 VOC 2.15 2.15 0.00 VOC Lead 0.00 0.00 0.00 Lead Difference <0.2 tpy Total On NOI Difference Criteria Emission Emission EmissionNOX0.00 0.55 0.55 Difference >0.2 tpy go with NOI to be conservative for RFO CO 0.01 0.05 0.04PM100.00 0.03 0.03 PM2.5 0.00 0.02 0.02 SO2 0.00 0.00 0.00 VOC 0.00 0.00 0.00 Lead 0.00 0.00 0.00 Silo Loading Hot Oil Heater Total On NOI Difference Emission Emission Emission 3.78 3.78 0.00 Low NOX control of 45% reduction (average of 35% and 55%) has 16.25 16.25 0.002.95 2.88 -0.07 2.79 2.77 -0.02 7.25 7.25 0.00 4.00 4.00 0.00 0.00 0.00 0.00 Difference <0.2 tpy Hot Oil Heater Blasting Formula for ANFO if Changed. Variables 0.070833 =B3/(B4^2)*H12*H15/2000 blast area/blast 6,195 ft2 PM10 PM2.5 Holes/blast 135 max blast area /year Scaling Factor 0.52 0.03 AP-42 Table 11.9-1 Blasts per Year 30 185856 ANFO used per blast 4.2 tons TSP Drill Shroud Control Efficiency 96%Drilling 1.3 lb/hole AP-42 Table 11.9-4 Assumes a maximum of one blast per day. At STP, 1L CO = 0.002751 lbs Hole Depth 40 feet Estimate Total On NOI Difference Pollutant Emission Rate (lbs/hr) Emission Total (tons/year) According to FACTORS AFFECTING ANFO FUMES PRODUCTION Figure 2 Hole Diameter 6 inches Estimate Criteria Pollutant Total (tons/yea r) Total (tons/yea r) Total (tons/yea r)NOX 0.30 0.11 1L CO/1kg ANFO=2.5 lb CO/ 1 ton ANFO 0.5 feet NOX 0.11 0.11 0.00 CO 11.73 4.22 Depends on % Fuel Content Hole Volume 7.853981634 ft3 CO 4.22 2.56 -1.66PM100.30 0.11 Assume 6% ,PM10 0.11 0.11 0.00 PM2.5 0.02 0.00 20L CO/1kg ANFO=50 lb CO/ 1 ton ANFO ANFO Density 0.85 g/cm3 Estimate PM2.5 0.00 0.01 0.01 SO2 0.35 0.13 Limit fuel % or increase PTE accordingly 53.0627866 lb/ft3 SO2 0.13 0.00 -0.13 Difference <0.2 tpy Emission Source TSP Emission Factor PM10 Emission Factor PM2.5 Emission Factor Reference Drilling (lb/hole)1.3 0.663 0.195 Blasting (lb/blast)6.827 3.550 0.205 Emission Source CO Emission Factor NOX Emission Factor SO2 Emission Factor Reference ANFO (lb/ton)67.00 1.70 2.00 AP-42 Table 13.3-1 Emission Source PM10 Emission Rate (lbs/hr) PM10 Emission Total (tons/year) PM2.5 Emission Rate (lbs/hr) PM2.5 Emission Total (tons/year) Drilling 0.15 0.05 0.01 0.00 Blasting 0.15 0.05 0.01 0.00 Drilling and Blasting AP-42 Table 11.9-1, Table 11.9-4 & Appendix B.2 Table B.2-2 Page 30 of Version 1.0 November 29, 2018 DAQE-MN158520002-22 M E M O R A N D U M TO: Christine Bodell, NSR Engineer FROM: Dave Prey, Air Quality Modeler DATE: September 9, 2022 SUBJECT: Modeling Analysis Review for the Notice of Intent for Kilgore Companies, LLC – Benjamin Pit, Utah County, Utah. __________________________________________________________________________________________ This is not a Major Prevention of Significant Deterioration (PSD) Source. I. OBJECTIVE Kilgore Companies, LLC (Applicant) is seeking an approval for their Benjamin Pit, located in Utah County, Utah. This facility consists of a concrete plant, an asphalt plant, and an aggregate processing plant. This report prepared by the staff of the NSR contains a review of the Applicant’s AQIA including the information, data, assumptions and modeling results used to determine if the facility would be in compliance with State and Federal concentration standards. II. APPLICABLE RULE(S) Utah Air Quality Rules: R307-401-6 Condition for Issuing an Approval Order R307-410-2 Use of Dispersion Models R307-410-4 Modeling of Criteria Pollutants in Attainment Areas R307-410-5 Documentation of Ambient Air Impacts for Hazardous Air Pollutants III. MODELING METHODOLOGY A. Applicability Emissions from the facility include HAPS, PM10, NOx, CO, SO2, and VOC. The emission increase for PM10 triggered the requirement for the applicant to perform a modeling analysis. Modeling for NO2 was updated even though there was an emissions decrease for NOx. 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 903-3978 www.deq.utah.gov Printed on 100% recycled paper State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director DP DP DAQE-MN158520002-22 Page 2 B. Assumptions 1. Topography/Terrain The Plant is at an elevation of 4814 feet with distant terrain features that have little effect on concentration predictions. a. Zone: 12 b. Approximate Location: UTM (NAD83): 431361 meters East 4439055 meters North 2. Urban or Rural Area Designation After a review of the appropriate 7.5 minute quadrangles, it was concluded that the area is “rural” for air modeling purposes. 3. Ambient Air It was determined that the Plant boundary used in the AQIA meets the State’s definition of ambient air. 4. Building Downwash The Applicant used the U.S. Environmental Protection Agency (USEPA) Building Profile Input Program (BPIP) to determine GEP stack heights and building dimensions for input into the AERMOD model. Parameters from the stacks and dimensions from buildings were input into the BPIP. It was assumed that ground level elevations for the stacks and buildings were the same. The output from BPIP showed all stacks to be less than their GEP formula stack height, thereby, required a wake effect evaluation. 5. Meteorology Five (5) years of off-site surface and upper air data was used in the analysis consisting of the following: Surface – Spanish Fork Airport, UT NWS: 2004 - 2008 Upper Air – Salt Lake City Airport, UT NWS: 2004 - 2008. 6. Background Background concentrations were based on ambient air data monitored in Lindon, Utah. 7. Receptor and Terrain Elevations DAQE-MN158520002-22 Page 3 The modeling domain used by the Applicant consisted of various receptors including property boundary receptors. This area of the state contains mountainous terrain and the modeling domain has simple and complex terrain features in the near and far fields. Therefore, receptor points representing actual terrain elevations from the area were used in the analysis. 8. Model and Options The US EPA AERMOD model was used by the Applicant to predict air pollutant concentrations under a simple/complex terrain/wake effect situation. In quantifying concentrations, the regulatory default option was selected by the Applicant. 9. Air Pollutant Emission Rates Source UTM Coordinates Modeled Emission Rates Easting Northing PM10 (m) (m) (lb/hr) (tons/yr) hrs/year SILO_LM 431375 4439065 0.0000 0.000 7344 SILO_FA 431364 4439015 0.0004 0.002 7344 PILENEW1 430938 4438929 0.2619 1.147 8760 PILENEW2 431131 4439217 0.2081 0.911 8760 PILEEX01 431112 4439274 0.0469 0.206 8760 PILEEX02 431141 4439378 0.1887 0.827 8760 PILEEX03 431166 4438979 0.1700 0.745 8760 PILEEX04 431263 4438969 0.1898 0.831 8760 PILEEX05 431322 4439165 0.2629 1.152 8760 PCR_1 431024 4439515 0.0607 0.266 8760 SCR_1 431157 4439240 0.1214 0.532 8760 TCR_1 431162 4439250 0.2429 1.064 8760 SCRN_1 431166 4439238 0.0857 0.375 8760 SCRN_2 431171 4439259 0.1667 0.730 8760 SCRN_3 431193 4439249 0.3333 1.460 8760 SCLP_SCR 431351 4439026 0.2960 1.087 7344 BF_RAP1 431346 4439045 0.0721 0.265 7344 BF_RAP2 431347 4439041 0.0721 0.265 7344 BF_RAP3 431348 4439037 0.0721 0.265 7344 BF_AG1 431366 4439100 0.0721 0.265 7344 BF_AG2 431366 4439095 0.0721 0.265 7344 DAQE-MN158520002-22 Page 4 BF_AG3 431366 4439091 0.0721 0.265 7344 BF_AG4 431367 4439087 0.0721 0.265 7344 BF_AG5 431368 4439083 0.0721 0.265 7344 FEED 431020 4439519 0.0207 0.091 8760 C_AG1 431151 4439226 0.0207 0.091 8760 C_AG2 431163 4439231 0.0207 0.091 8760 C_AG3 431162 4439228 0.0207 0.091 8760 C_AG4 431178 4439222 0.0207 0.091 8760 C_AG5 431166 4439236 0.0207 0.091 8760 C_AG6 431163 4439237 0.0207 0.091 8760 C_AG7 431156 4439238 0.0207 0.091 8760 C_AG8 431159 4439243 0.0207 0.091 8760 C_AG9 431170 4439247 0.0207 0.091 8760 C_AG10 431162 4439250 0.0207 0.091 8760 C_AG11 431172 4439256 0.0207 0.091 8760 C_AG12 431175 4439254 0.0207 0.091 8760 C_AG13 431176 4439257 0.0207 0.091 8760 C_AG14 431183 4439245 0.0207 0.091 8760 C_AG15 431190 4439241 0.0207 0.091 8760 C_AG16 431191 4439243 0.0207 0.091 8760 C_AG17 431193 4439245 0.0207 0.091 8760 C_AG18 431193 4439253 0.0207 0.091 8760 C_AG19 431144 4439228 0.0207 0.091 8760 C_AG20 431153 4439232 0.0207 0.091 8760 C_AG21 431157 4439239 0.0207 0.091 8760 C_AG22 431166 4439261 0.0207 0.091 8760 C_AG23 431173 4439245 0.0207 0.091 8760 C_AG24 431193 4439251 0.0207 0.091 8760 C_AG25 431187 4439241 0.0207 0.091 8760 C_HMA1 431368 4439074 0.0184 0.068 7344 C_HMA2 431369 4439065 0.0184 0.068 7344 C_HMA3 431370 4439053 0.0184 0.068 7344 C_HMA4 431371 4439045 0.0184 0.068 7344 C_HMA5 431353 4439026 0.0184 0.068 7344 C_HMA6 431369 4439028 0.0184 0.068 7344 STCK1 431163 4439280 0.3246 1.422 8760 STCK2 431210 4439259 0.3246 1.422 8760 DAQE-MN158520002-22 Page 5 STCK3 431209 4439249 0.3246 1.422 8760 STCK4 431204 4439240 0.3246 1.422 8760 STCK5 431185 4439231 0.3246 1.422 8760 STCK6 431204 4439220 0.3246 1.422 8760 LD1 431016 4439526 0.3246 1.422 8760 LD2 431250 4439212 0.3246 1.422 8760 LD3 431280 4439160 0.3246 1.422 8760 LD4 431366 4439091 0.2889 1.265 8760 LD5 431347 4439041 0.2889 1.061 7344 BL_50.07 431011 4439193 3.6112 0.659 365 DRILL07 431011 4439193 0.1516 0.277 3650 DSTGR07 431038 4439167 0.0155 0.068 8760 SILO_LD 431396 4439037 0.0167 0.061 7344 SILO_OUT 431395 4439028 0.0149 0.055 7344 HOH 431368 4438997 0.0078 0.029 7344 DMD 431360 4439055 0.6564 2.410 7344 BLLDZR 430980 4439640 0.0463 0.203 8760 A60XA000 431131 4439315 0.0207 0.091 8760 Roads: OUTPAD 0.0711 0.3115 INPAVD 0.0694 0.3042 OUTUND 0.8545 3.7429 INUNPD 0.1909 0.8360 LD_AGB 0.0300 0.1102 LD_RPB 0.0089 0.0326 LD_AGH 0.0517 0.2267 LD_AGF 0.1295 0.5673 LD_AGS 0.1040 0.4554 Total 13.41 41.78 Source UTM Coordinates Modeled Emission Rates Easting Northing Nox (m) (m) (lb/hr) (tons/yr) hrs/year HOH 431368 4438997 0.1254 0.460 7344 DRY 431360 4439055 0.8651 3.177 7344 DAQE-MN158520002-22 Page 6 BL_50 430988 4438849 7.6510 1.396 365 Total 8.64 5.03 11. Source Location and Parameters Source Type Source Parameters Elev, Ht Temp Flow Dia Sigma- Y Sigma- Z X- Dim Y- Dim Area (ft) (m) (ft) (K) (m/s) (m) (m) (m) (m) (m) (m^2) SILO_LM POINT 4813.5 9.1 30.0 361 25.14 1.29 0.00 1 SILO_FA POINT 4826.6 9.1 30.0 361 25.14 1.29 0.00 1 PILENEW1 AREA_POLY 5104.0 3.1 10.0 0.00 1.42 13033 PILENEW2 AREA_POLY 4913.8 3.1 10.0 0.00 1.42 10355.1 PILEEX01 AREA_POLY 4915.8 3.1 10.0 0.00 1.42 1281.7 PILEEX02 AREA_POLY 4891.4 3.1 10.0 0.00 1.42 5152.8 PILEEX03 AREA_POLY 4940.6 3.1 10.0 0.00 1.42 4642.3 PILEEX04 AREA_POLY 4877.4 3.1 10.0 0.00 1.42 5182.2 PILEEX05 AREA_POLY 4835.4 3.1 10.0 0.00 1.42 7178.1 PCR_1 VOLUME 5023.4 2.3 7.5 0.00 2.13 2.4385 1 SCR_1 VOLUME 4897.8 2.3 7.5 0.00 2.13 2.027 1 TCR_1 VOLUME 4892.6 2.3 7.5 0.00 2.13 0.9146 1 SCRN_1 VOLUME 4894.3 2.1 7.0 0.00 1.98 2.4385 1 SCRN_2 VOLUME 4885.5 2.1 7.0 0.00 1.98 2.4385 1 SCRN_3 VOLUME 4877.3 2.1 7.0 0.00 1.98 2.4385 1 SCLP_SCR VOLUME 4835.9 2.3 7.5 0.00 2.13 1.8288 1 BF_RAP1 VOLUME 4835.1 2.3 7.5 0.00 1.06 0.9146 1 BF_RAP2 VOLUME 4834.8 2.3 7.5 0.00 1.06 0.9146 1 BF_RAP3 VOLUME 4835.0 2.3 7.5 0.00 1.06 0.9146 1 BF_AG1 VOLUME 4817.0 2.3 7.5 0.00 1.06 0.9146 1 BF_AG2 VOLUME 4815.8 2.3 7.5 0.00 1.06 0.9146 1 BF_AG3 VOLUME 4814.8 2.3 7.5 0.00 1.06 0.9146 1 BF_AG4 VOLUME 4814.5 2.3 7.5 0.00 1.06 0.9146 1 BF_AG5 VOLUME 4814.5 2.3 7.5 0.00 1.06 0.9146 1 FEED VOLUME 5028.0 2.3 7.5 0.00 1.06 0.9146 1 DAQE-MN158520002-22 Page 7 C_AG1 VOLUME 4904.6 1.2 4.0 0.00 0.28 0.9146 1 C_AG2 VOLUME 4897.2 1.2 4.0 0.00 0.28 0.9146 1 C_AG3 VOLUME 4898.3 1.2 4.0 0.00 0.28 0.9146 1 C_AG4 VOLUME 4890.6 1.2 4.0 0.00 0.28 0.9146 1 C_AG5 VOLUME 4894.6 1.2 4.0 0.00 0.28 0.9146 1 C_AG6 VOLUME 4895.9 1.2 4.0 0.00 0.28 0.9146 1 C_AG7 VOLUME 4898.8 1.2 4.0 0.00 0.28 0.9146 1 C_AG8 VOLUME 4896.3 1.2 4.0 0.00 0.28 0.9146 1 C_AG9 VOLUME 4890.1 1.2 4.0 0.00 0.28 0.9146 1 C_AG10 VOLUME 4892.6 1.2 4.0 0.00 0.28 0.9146 1 C_AG11 VOLUME 4886.0 1.2 4.0 0.00 0.28 0.9146 1 C_AG12 VOLUME 4885.4 1.2 4.0 0.00 0.28 0.9146 1 C_AG13 VOLUME 4884.0 1.2 4.0 0.00 0.28 0.9146 1 C_AG14 VOLUME 4884.2 1.2 4.0 0.00 0.28 0.9146 1 C_AG15 VOLUME 4880.2 1.2 4.0 0.00 0.28 0.9146 1 C_AG16 VOLUME 4879.4 1.2 4.0 0.00 0.28 0.9146 1 C_AG17 VOLUME 4878.0 1.2 4.0 0.00 0.28 0.9146 1 C_AG18 VOLUME 4876.7 1.2 4.0 0.00 0.28 0.9146 1 C_AG19 VOLUME 4907.7 1.2 4.0 0.00 0.28 0.9146 1 C_AG20 VOLUME 4901.6 1.2 4.0 0.00 0.28 0.9146 1 C_AG21 VOLUME 4898.1 1.2 4.0 0.00 0.28 0.9146 1 C_AG22 VOLUME 4887.1 1.2 4.0 0.00 0.28 0.9146 1 C_AG23 VOLUME 4889.2 1.2 4.0 0.00 0.28 0.9146 1 C_AG24 VOLUME 4877.1 1.2 4.0 0.00 0.28 0.9146 1 C_AG25 VOLUME 4882.0 1.2 4.0 0.00 0.28 0.9146 1 C_HMA1 VOLUME 4814.7 1.2 4.0 0.00 0.28 0.9146 1 C_HMA2 VOLUME 4814.8 1.2 4.0 0.00 0.28 0.9146 1 C_HMA3 VOLUME 4816.4 1.2 4.0 0.00 0.28 0.9146 1 C_HMA4 VOLUME 4816.6 1.2 4.0 0.00 0.28 0.9146 1 C_HMA5 VOLUME 4835.0 1.2 4.0 0.00 0.28 0.9146 1 C_HMA6 VOLUME 4817.1 1.2 4.0 0.00 0.28 0.9146 1 STCK1 VOLUME 4884.2 7.9 26.0 0.00 0.85 0.9146 1 STCK2 VOLUME 4865.4 7.9 26.0 0.00 0.85 0.9146 1 STCK3 VOLUME 4868.7 7.9 26.0 0.00 0.85 0.9146 1 STCK4 VOLUME 4872.3 7.9 26.0 0.00 0.85 0.9146 1 STCK5 VOLUME 4884.5 7.9 26.0 0.00 0.85 0.9146 1 STCK6 VOLUME 4876.4 7.9 26.0 0.00 0.85 0.9146 1 DAQE-MN158520002-22 Page 8 LD1 VOLUME 5032.9 3.8 12.5 0.00 1.06 4.5722 1 LD2 VOLUME 4853.0 3.8 12.5 0.00 1.06 30.48 1 LD3 VOLUME 4849.1 3.8 12.5 0.00 1.06 30.48 1 LD4 VOLUME 4814.9 3.8 12.5 0.00 1.06 24.994 1 LD5 VOLUME 4834.9 3.8 12.5 0.00 1.06 9.144 1 BL_50.07 VOLUME 4980.7 7.6 25.0 0.00 7.09 42.19 1 DRILL07 VOLUME 4980.7 0.8 2.5 0.00 0.71 24.12 1 DSTGR07 AREA_CIRC 4984.1 0.0 0.0 37.50 0.00 2.00 4417.8647 SILO_LD POINT 4808.4 9.1 30.0 361 25.14 1.29 0.00 1 SILO_OUT POINT 4807.8 9.1 30.0 361 25.14 1.29 0.00 1 HOH POINT 4821.9 9.1 30.0 605 6.58 0.20 0.00 1 DMD POINT 4817.4 9.1 30.0 505 0.16 1.32 0.00 1 BLLDZR AREA_POLY 4993.2 3.4 11.2 0.00 0.00 20827.1 A60XA000 VOLUME 4900.3 1.2 4.0 0.00 0.28 0.9146 1 OUTPAD01 VOLUME 4753.0 2.6 8.4 0.00 2.37 27.993 1 OUTPAD02 VOLUME 4752.8 2.6 8.4 0.00 2.37 27.993 1 OUTPAD03 VOLUME 4753.0 2.6 8.4 0.00 2.37 27.993 1 OUTPAD04 VOLUME 4752.4 2.6 8.4 0.00 2.37 27.993 1 OUTPAD05 VOLUME 4752.1 2.6 8.4 0.00 2.37 27.993 1 OUTPAD06 VOLUME 4751.1 2.6 8.4 0.00 2.37 27.993 1 OUTPAD07 VOLUME 4749.7 2.6 8.4 0.00 2.37 27.993 1 OUTPAD08 VOLUME 4747.0 2.6 8.4 0.00 2.37 27.993 1 OUTPAD09 VOLUME 4744.3 2.6 8.4 0.00 2.37 27.993 1 OUTPAD10 VOLUME 4742.6 2.6 8.4 0.00 2.37 27.993 1 OUTPAD11 VOLUME 4742.2 2.6 8.4 0.00 2.37 27.993 1 OUTPAD12 VOLUME 4742.1 2.6 8.4 0.00 2.37 27.993 1 OUTPAD13 VOLUME 4742.8 2.6 8.4 0.00 2.37 27.993 1 OUTPAD14 VOLUME 4742.2 2.6 8.4 0.00 2.37 27.993 1 OUTPAD15 VOLUME 4738.8 2.6 8.4 0.00 2.37 27.993 1 OUTPAD16 VOLUME 4735.2 2.6 8.4 0.00 2.37 27.993 1 OUTPAD17 VOLUME 4731.0 2.6 8.4 0.00 2.37 27.993 1 OUTPAD18 VOLUME 4730.5 2.6 8.4 0.00 2.37 27.993 1 OUTPAD19 VOLUME 4734.2 2.6 8.4 0.00 2.37 27.993 1 OUTPAD20 VOLUME 4738.1 2.6 8.4 0.00 2.37 27.993 1 OUTPAD21 VOLUME 4740.6 2.6 8.4 0.00 2.37 27.993 1 OUTPAD22 VOLUME 4741.4 2.6 8.4 0.00 2.37 27.993 1 OUTPAD23 VOLUME 4740.2 2.6 8.4 0.00 2.37 27.993 1 DAQE-MN158520002-22 Page 9 OUTPAD24 VOLUME 4739.9 2.6 8.4 0.00 2.37 27.993 1 OUTPAD25 VOLUME 4740.1 2.6 8.4 0.00 2.37 27.993 1 OUTPAD26 VOLUME 4740.4 2.6 8.4 0.00 2.37 27.993 1 OUTPAD27 VOLUME 4741.3 2.6 8.4 0.00 2.37 27.993 1 OUTPAD28 VOLUME 4742.2 2.6 8.4 0.00 2.37 27.993 1 OUTPAD29 VOLUME 4742.6 2.6 8.4 0.00 2.37 27.993 1 OUTPAD30 VOLUME 4742.9 2.6 8.4 0.00 2.37 27.993 1 OUTPAD31 VOLUME 4743.5 2.6 8.4 0.00 2.37 27.993 1 OUTPAD32 VOLUME 4742.9 2.6 8.4 0.00 2.37 27.993 1 OUTPAD33 VOLUME 4743.3 2.6 8.4 0.00 2.37 27.993 1 OUTPAD34 VOLUME 4746.6 2.6 8.4 0.00 2.37 27.993 1 OUTPAD35 VOLUME 4749.0 2.6 8.4 0.00 2.37 27.993 1 INPAVD01 VOLUME 4753.0 2.6 8.4 0.00 2.37 27.993 1 INPAVD02 VOLUME 4752.8 2.6 8.4 0.00 2.37 27.993 1 INPAVD03 VOLUME 4753.0 2.6 8.4 0.00 2.37 27.993 1 INPAVD04 VOLUME 4752.4 2.6 8.4 0.00 2.37 27.993 1 INPAVD05 VOLUME 4752.1 2.6 8.4 0.00 2.37 27.993 1 INPAVD06 VOLUME 4751.1 2.6 8.4 0.00 2.37 27.993 1 INPAVD07 VOLUME 4749.7 2.6 8.4 0.00 2.37 27.993 1 INPAVD08 VOLUME 4747.0 2.6 8.4 0.00 2.37 27.993 1 INPAVD09 VOLUME 4744.3 2.6 8.4 0.00 2.37 27.993 1 INPAVD10 VOLUME 4742.6 2.6 8.4 0.00 2.37 27.993 1 INPAVD11 VOLUME 4742.2 2.6 8.4 0.00 2.37 27.993 1 INPAVD12 VOLUME 4742.1 2.6 8.4 0.00 2.37 27.993 1 INPAVD13 VOLUME 4742.8 2.6 8.4 0.00 2.37 27.993 1 INPAVD14 VOLUME 4742.2 2.6 8.4 0.00 2.37 27.993 1 INPAVD15 VOLUME 4738.8 2.6 8.4 0.00 2.37 27.993 1 INPAVD16 VOLUME 4735.2 2.6 8.4 0.00 2.37 27.993 1 INPAVD17 VOLUME 4731.0 2.6 8.4 0.00 2.37 27.993 1 INPAVD18 VOLUME 4730.5 2.6 8.4 0.00 2.37 27.993 1 INPAVD19 VOLUME 4734.2 2.6 8.4 0.00 2.37 27.993 1 INPAVD20 VOLUME 4738.1 2.6 8.4 0.00 2.37 27.993 1 INPAVD21 VOLUME 4740.6 2.6 8.4 0.00 2.37 27.993 1 INPAVD22 VOLUME 4741.4 2.6 8.4 0.00 2.37 27.993 1 INPAVD23 VOLUME 4740.2 2.6 8.4 0.00 2.37 27.993 1 INPAVD24 VOLUME 4739.9 2.6 8.4 0.00 2.37 27.993 1 INPAVD25 VOLUME 4740.1 2.6 8.4 0.00 2.37 27.993 1 DAQE-MN158520002-22 Page 10 INPAVD26 VOLUME 4740.4 2.6 8.4 0.00 2.37 27.993 1 INPAVD27 VOLUME 4741.3 2.6 8.4 0.00 2.37 27.993 1 INPAVD28 VOLUME 4742.2 2.6 8.4 0.00 2.37 27.993 1 INPAVD29 VOLUME 4742.6 2.6 8.4 0.00 2.37 27.993 1 INPAVD30 VOLUME 4742.9 2.6 8.4 0.00 2.37 27.993 1 INPAVD31 VOLUME 4743.5 2.6 8.4 0.00 2.37 27.993 1 INPAVD32 VOLUME 4742.9 2.6 8.4 0.00 2.37 27.993 1 INPAVD33 VOLUME 4743.3 2.6 8.4 0.00 2.37 27.993 1 INPAVD34 VOLUME 4746.6 2.6 8.4 0.00 2.37 27.993 1 INPAVD35 VOLUME 4749.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND01 VOLUME 4754.5 2.6 8.4 0.00 2.37 27.993 1 OUTUND02 VOLUME 4757.7 2.6 8.4 0.00 2.37 27.993 1 OUTUND03 VOLUME 4761.7 2.6 8.4 0.00 2.37 27.993 1 OUTUND04 VOLUME 4766.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND05 VOLUME 4769.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND06 VOLUME 4773.3 2.6 8.4 0.00 2.37 27.993 1 OUTUND07 VOLUME 4776.5 2.6 8.4 0.00 2.37 27.993 1 OUTUND08 VOLUME 4780.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND09 VOLUME 4783.6 2.6 8.4 0.00 2.37 27.993 1 OUTUND10 VOLUME 4786.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND11 VOLUME 4787.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND12 VOLUME 4788.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND13 VOLUME 4791.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND14 VOLUME 4793.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND15 VOLUME 4794.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND16 VOLUME 4797.6 2.6 8.4 0.00 2.37 27.993 1 OUTUND17 VOLUME 4799.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND18 VOLUME 4800.1 2.6 8.4 0.00 2.37 27.993 1 OUTUND19 VOLUME 4802.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND20 VOLUME 4803.1 2.6 8.4 0.00 2.37 27.993 1 OUTUND21 VOLUME 4805.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND22 VOLUME 4806.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND23 VOLUME 4810.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND24 VOLUME 4813.3 2.6 8.4 0.00 2.37 27.993 1 OUTUND25 VOLUME 4815.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND26 VOLUME 4816.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND27 VOLUME 4817.7 2.6 8.4 0.00 2.37 27.993 1 DAQE-MN158520002-22 Page 11 OUTUND28 VOLUME 4819.5 2.6 8.4 0.00 2.37 27.993 1 OUTUND29 VOLUME 4821.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND30 VOLUME 4823.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND31 VOLUME 4824.7 2.6 8.4 0.00 2.37 27.993 1 OUTUND32 VOLUME 4829.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND33 VOLUME 4833.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND34 VOLUME 4837.1 2.6 8.4 0.00 2.37 27.993 1 OUTUND35 VOLUME 4839.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND36 VOLUME 4840.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND37 VOLUME 4842.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND38 VOLUME 4844.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND39 VOLUME 4847.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND40 VOLUME 4850.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND41 VOLUME 4852.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND42 VOLUME 4852.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND43 VOLUME 4855.3 2.6 8.4 0.00 2.37 27.993 1 OUTUND44 VOLUME 4856.1 2.6 8.4 0.00 2.37 27.993 1 OUTUND45 VOLUME 4858.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND46 VOLUME 4864.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND47 VOLUME 4869.5 2.6 8.4 0.00 2.37 27.993 1 OUTUND48 VOLUME 4872.5 2.6 8.4 0.00 2.37 27.993 1 OUTUND49 VOLUME 4874.6 2.6 8.4 0.00 2.37 27.993 1 OUTUND50 VOLUME 4876.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND51 VOLUME 4877.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND52 VOLUME 4882.3 2.6 8.4 0.00 2.37 27.993 1 OUTUND53 VOLUME 4882.7 2.6 8.4 0.00 2.37 27.993 1 OUTUND54 VOLUME 4883.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND55 VOLUME 4883.7 2.6 8.4 0.00 2.37 27.993 1 OUTUND56 VOLUME 4884.1 2.6 8.4 0.00 2.37 27.993 1 OUTUND57 VOLUME 4884.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND58 VOLUME 4884.7 2.6 8.4 0.00 2.37 27.993 1 OUTUND59 VOLUME 4885.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND60 VOLUME 4886.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND61 VOLUME 4884.1 2.6 8.4 0.00 2.37 27.993 1 OUTUND62 VOLUME 4883.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND63 VOLUME 4882.3 2.6 8.4 0.00 2.37 27.993 1 OUTUND64 VOLUME 4880.3 2.6 8.4 0.00 2.37 27.993 1 DAQE-MN158520002-22 Page 12 OUTUND65 VOLUME 4878.5 2.6 8.4 0.00 2.37 27.993 1 OUTUND66 VOLUME 4877.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND67 VOLUME 4875.7 2.6 8.4 0.00 2.37 27.993 1 OUTUND68 VOLUME 4872.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND69 VOLUME 4870.6 2.6 8.4 0.00 2.37 27.993 1 OUTUND70 VOLUME 4864.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND71 VOLUME 4855.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND72 VOLUME 4853.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND73 VOLUME 4855.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND74 VOLUME 4854.7 2.6 8.4 0.00 2.37 27.993 1 OUTUND75 VOLUME 4848.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND76 VOLUME 4840.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND77 VOLUME 4835.1 2.6 8.4 0.00 2.37 27.993 1 OUTUND78 VOLUME 4830.9 2.6 8.4 0.00 2.37 27.993 1 OUTUND79 VOLUME 4827.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND80 VOLUME 4822.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND81 VOLUME 4819.5 2.6 8.4 0.00 2.37 27.993 1 OUTUND82 VOLUME 4815.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND83 VOLUME 4807.6 2.6 8.4 0.00 2.37 27.993 1 OUTUND84 VOLUME 4800.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND85 VOLUME 4795.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND86 VOLUME 4789.8 2.6 8.4 0.00 2.37 27.993 1 OUTUND87 VOLUME 4784.6 2.6 8.4 0.00 2.37 27.993 1 OUTUND88 VOLUME 4780.4 2.6 8.4 0.00 2.37 27.993 1 OUTUND89 VOLUME 4777.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND90 VOLUME 4774.7 2.6 8.4 0.00 2.37 27.993 1 OUTUND91 VOLUME 4774.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND92 VOLUME 4770.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND93 VOLUME 4765.2 2.6 8.4 0.00 2.37 27.993 1 OUTUND94 VOLUME 4759.5 2.6 8.4 0.00 2.37 27.993 1 OUTUND95 VOLUME 4756.5 2.6 8.4 0.00 2.37 27.993 1 OUTUND96 VOLUME 4754.0 2.6 8.4 0.00 2.37 27.993 1 OUTUND97 VOLUME 4751.4 2.6 8.4 0.00 2.37 27.993 1 INUNPD01 VOLUME 4754.5 2.6 8.4 0.00 2.37 27.993 1 INUNPD02 VOLUME 4757.7 2.6 8.4 0.00 2.37 27.993 1 INUNPD03 VOLUME 4761.7 2.6 8.4 0.00 2.37 27.993 1 INUNPD04 VOLUME 4766.0 2.6 8.4 0.00 2.37 27.993 1 DAQE-MN158520002-22 Page 13 INUNPD05 VOLUME 4769.9 2.6 8.4 0.00 2.37 27.993 1 INUNPD06 VOLUME 4773.3 2.6 8.4 0.00 2.37 27.993 1 INUNPD07 VOLUME 4776.5 2.6 8.4 0.00 2.37 27.993 1 INUNPD08 VOLUME 4780.9 2.6 8.4 0.00 2.37 27.993 1 INUNPD09 VOLUME 4783.6 2.6 8.4 0.00 2.37 27.993 1 INUNPD10 VOLUME 4786.8 2.6 8.4 0.00 2.37 27.993 1 INUNPD11 VOLUME 4787.9 2.6 8.4 0.00 2.37 27.993 1 INUNPD12 VOLUME 4788.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD13 VOLUME 4791.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD14 VOLUME 4793.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD15 VOLUME 4794.8 2.6 8.4 0.00 2.37 27.993 1 INUNPD16 VOLUME 4797.6 2.6 8.4 0.00 2.37 27.993 1 INUNPD17 VOLUME 4799.9 2.6 8.4 0.00 2.37 27.993 1 INUNPD18 VOLUME 4800.1 2.6 8.4 0.00 2.37 27.993 1 INUNPD19 VOLUME 4802.0 2.6 8.4 0.00 2.37 27.993 1 INUNPD20 VOLUME 4803.1 2.6 8.4 0.00 2.37 27.993 1 INUNPD21 VOLUME 4805.8 2.6 8.4 0.00 2.37 27.993 1 INUNPD22 VOLUME 4808.5 2.6 8.4 0.00 2.37 27.993 1 INUNPD23 VOLUME 4811.5 2.6 8.4 0.00 2.37 27.993 1 INUNPD24 VOLUME 4814.6 2.6 8.4 0.00 2.37 27.993 1 INUNPD25 VOLUME 4818.4 2.6 8.4 0.00 2.37 27.993 1 INUNPD26 VOLUME 4822.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD27 VOLUME 4823.6 2.6 8.4 0.00 2.37 27.993 1 INUNPD28 VOLUME 4825.4 2.6 8.4 0.00 2.37 27.993 1 INUNPD29 VOLUME 4828.0 2.6 8.4 0.00 2.37 27.993 1 INUNPD30 VOLUME 4834.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD31 VOLUME 4837.0 2.6 8.4 0.00 2.37 27.993 1 INUNPD32 VOLUME 4838.6 2.6 8.4 0.00 2.37 27.993 1 INUNPD33 VOLUME 4840.3 2.6 8.4 0.00 2.37 27.993 1 INUNPD34 VOLUME 4840.6 2.6 8.4 0.00 2.37 27.993 1 INUNPD35 VOLUME 4839.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD36 VOLUME 4839.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD37 VOLUME 4842.4 2.6 8.4 0.00 2.37 27.993 1 INUNPD38 VOLUME 4844.5 2.6 8.4 0.00 2.37 27.993 1 INUNPD39 VOLUME 4841.1 2.6 8.4 0.00 2.37 27.993 1 INUNPD40 VOLUME 4838.7 2.6 8.4 0.00 2.37 27.993 1 INUNPD41 VOLUME 4838.2 2.6 8.4 0.00 2.37 27.993 1 DAQE-MN158520002-22 Page 14 INUNPD42 VOLUME 4835.9 2.6 8.4 0.00 2.37 27.993 1 INUNPD43 VOLUME 4832.7 2.6 8.4 0.00 2.37 27.993 1 INUNPD44 VOLUME 4826.9 2.6 8.4 0.00 2.37 27.993 1 INUNPD45 VOLUME 4819.6 2.6 8.4 0.00 2.37 27.993 1 INUNPD46 VOLUME 4815.3 2.6 8.4 0.00 2.37 27.993 1 INUNPD47 VOLUME 4810.9 2.6 8.4 0.00 2.37 27.993 1 INUNPD48 VOLUME 4810.8 2.6 8.4 0.00 2.37 27.993 1 INUNPD49 VOLUME 4807.4 2.6 8.4 0.00 2.37 27.993 1 INUNPD50 VOLUME 4804.0 2.6 8.4 0.00 2.37 27.993 1 INUNPD51 VOLUME 4801.3 2.6 8.4 0.00 2.37 27.993 1 INUNPD52 VOLUME 4798.0 2.6 8.4 0.00 2.37 27.993 1 INUNPD53 VOLUME 4793.0 2.6 8.4 0.00 2.37 27.993 1 INUNPD54 VOLUME 4788.5 2.6 8.4 0.00 2.37 27.993 1 INUNPD55 VOLUME 4784.6 2.6 8.4 0.00 2.37 27.993 1 INUNPD56 VOLUME 4780.4 2.6 8.4 0.00 2.37 27.993 1 INUNPD57 VOLUME 4777.0 2.6 8.4 0.00 2.37 27.993 1 INUNPD58 VOLUME 4774.7 2.6 8.4 0.00 2.37 27.993 1 INUNPD59 VOLUME 4774.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD60 VOLUME 4770.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD61 VOLUME 4765.2 2.6 8.4 0.00 2.37 27.993 1 INUNPD62 VOLUME 4759.5 2.6 8.4 0.00 2.37 27.993 1 INUNPD63 VOLUME 4756.5 2.6 8.4 0.00 2.37 27.993 1 INUNPD64 VOLUME 4754.0 2.6 8.4 0.00 2.37 27.993 1 INUNPD65 VOLUME 4751.4 2.6 8.4 0.00 2.37 27.993 1 LD_AGB01 VOLUME 4843.6 2.6 8.4 0.00 2.37 31.992 1 LD_AGB02 VOLUME 4841.6 2.6 8.4 0.00 2.37 31.992 1 LD_AGB03 VOLUME 4839.3 2.6 8.4 0.00 2.37 31.992 1 LD_AGB04 VOLUME 4837.8 2.6 8.4 0.00 2.37 31.992 1 LD_AGB05 VOLUME 4834.5 2.6 8.4 0.00 2.37 31.992 1 LD_AGB06 VOLUME 4825.5 2.6 8.4 0.00 2.37 31.992 1 LD_AGB07 VOLUME 4819.1 2.6 8.4 0.00 2.37 31.992 1 LD_RPB01 VOLUME 4823.4 2.6 8.4 0.00 2.37 31.992 1 LD_RPB02 VOLUME 4822.7 2.6 8.4 0.00 2.37 31.992 1 LD_RPB03 VOLUME 4825.6 2.6 8.4 0.00 2.37 31.992 1 LD_RPB04 VOLUME 4827.8 2.6 8.4 0.00 2.37 31.992 1 LD_RPB05 VOLUME 4833.5 2.6 8.4 0.00 2.37 31.992 1 LD_RPB06 VOLUME 4836.0 2.6 8.4 0.00 2.37 31.992 1 DAQE-MN158520002-22 Page 15 LD_RPB07 VOLUME 4837.1 2.6 8.4 0.00 2.37 31.992 1 LD_RPB08 VOLUME 4838.6 2.6 8.4 0.00 2.37 31.992 1 LD_RPB09 VOLUME 4841.8 2.6 8.4 0.00 2.37 31.992 1 LD_RPB10 VOLUME 4843.9 2.6 8.4 0.00 2.37 31.992 1 LD_RPB11 VOLUME 4841.3 2.6 8.4 0.00 2.37 31.992 1 LD_RPB12 VOLUME 4838.8 2.6 8.4 0.00 2.37 31.992 1 LD_RPB13 VOLUME 4839.2 2.6 8.4 0.00 2.37 31.992 1 LD_RPB14 VOLUME 4840.0 2.6 8.4 0.00 2.37 31.992 1 LD_RPB15 VOLUME 4838.5 2.6 8.4 0.00 2.37 31.992 1 LD_RPB16 VOLUME 4834.7 2.6 8.4 0.00 2.37 31.992 1 LD_AGH01 VOLUME 4877.1 2.6 8.4 0.00 2.37 31.992 1 LD_AGH02 VOLUME 4881.1 2.6 8.4 0.00 2.37 31.992 1 LD_AGH03 VOLUME 4882.6 2.6 8.4 0.00 2.37 31.992 1 LD_AGH04 VOLUME 4882.4 2.6 8.4 0.00 2.37 31.992 1 LD_AGF01 VOLUME 5127.5 2.6 8.4 0.00 2.37 31.992 1 LD_AGF02 VOLUME 5119.3 2.6 8.4 0.00 2.37 31.992 1 LD_AGF03 VOLUME 5112.2 2.6 8.4 0.00 2.37 31.992 1 LD_AGF04 VOLUME 5103.6 2.6 8.4 0.00 2.37 31.992 1 LD_AGF05 VOLUME 5093.0 2.6 8.4 0.00 2.37 31.992 1 LD_AGF06 VOLUME 5082.3 2.6 8.4 0.00 2.37 31.992 1 LD_AGF07 VOLUME 5072.4 2.6 8.4 0.00 2.37 31.992 1 LD_AGF08 VOLUME 5062.9 2.6 8.4 0.00 2.37 31.992 1 LD_AGF09 VOLUME 5051.9 2.6 8.4 0.00 2.37 31.992 1 LD_AGF10 VOLUME 5041.9 2.6 8.4 0.00 2.37 31.992 1 LD_AGF11 VOLUME 5039.7 2.6 8.4 0.00 2.37 31.992 1 LD_AGF12 VOLUME 5037.6 2.6 8.4 0.00 2.37 31.992 1 LD_AGF13 VOLUME 5033.6 2.6 8.4 0.00 2.37 31.992 1 LD_AGF14 VOLUME 5028.9 2.6 8.4 0.00 2.37 31.992 1 LD_AGF15 VOLUME 5021.3 2.6 8.4 0.00 2.37 31.992 1 LD_AGF16 VOLUME 5013.2 2.6 8.4 0.00 2.37 31.992 1 LD_AGF17 VOLUME 5009.8 2.6 8.4 0.00 2.37 31.992 1 LD_AGS01 VOLUME 4873.6 2.6 8.4 0.00 2.37 31.992 1 LD_AGS02 VOLUME 4869.0 2.6 8.4 0.00 2.37 31.992 1 LD_AGS03 VOLUME 4864.4 2.6 8.4 0.00 2.37 31.992 1 LD_AGS04 VOLUME 4860.2 2.6 8.4 0.00 2.37 31.992 1 LD_AGS05 VOLUME 4859.8 2.6 8.4 0.00 2.37 31.992 1 LD_AGS06 VOLUME 4855.4 2.6 8.4 0.00 2.37 31.992 1 DAQE-MN158520002-22 Page 16 LD_AGS07 VOLUME 4851.3 2.6 8.4 0.00 2.37 31.992 1 LD_AGS08 VOLUME 4849.0 2.6 8.4 0.00 2.37 31.992 1 LD_AGS09 VOLUME 4848.0 2.6 8.4 0.00 2.37 31.992 1 LD_AGS10 VOLUME 4847.1 2.6 8.4 0.00 2.37 31.992 1 IV. RESULTS AND CONCLUSIONS A. NAAQS The below table provides a comparison of the predicted total air quality concentrations with the National Ambient Air Quality Standards (NAAQS). The predicted total concentrations are less than the NAAQS. Air Pollutant Period Prediction Class II Significant Impact Level Background Nearby Sources* Total NAAQS Percent (μg/m3) (μg/m3) (μg/m3) (μg/m3) (μg/m3) (μg/m3) NAAQS NO2 1-Hour 104.2 7.5 73.1 0.0 177.3 188 94.3% Annual 3.1 1.0 13.4 0.0 16.5 100 16.5% Pollutant Period Prediction Others Background Total NAAQS Percent (μg/m3) (μg/m3) (μg/m3) (μg/m3) (μg/m3) NAAQS PM10 24-Hour 95.83 0.00 53 148.8 150 99.2% V. PERMIT CONDITIONS The following suggested permit language should be included under the Terms and Conditions in the AO.  Blasting operations are limited to between 10:00 am and 2:00 pm daily.  Drilling emissions are limited to between 7:00 am and 5:00 pm daily.  Operation of the HMA Plant and associated facility activities shall not operate during January and February of each year. DP:jg {{#d1=date1_es_:signer1:date:format(date, "mmmm d, yyyy")}} {{#s=Sig_es_:signer1:signature}} Signature: Email: Signature: Email: # - $ . / $ ) * ' ' — + @ A v A ? A A @ @ w ? ? ˜ cbodell@utah.gov Dave re4 (Sep 1т, 2022 0ч:02 MDT) dpre4@utah.gov MEMORANDUM 4525 Wasatch Blvd, Ste 200, Salt Lake City, UT 84124 P 801.272.3000 / F 801.272.3040 To: Christine Bodell, Utah Division of Air Quality cc: Lee Ware, Kilgore Companies Brian Mensinger, Trinity Consultants From: Chase Peterson, Trinity Consultants Date: March 11, 2022 RE: Response to Questions Issued Regarding the NOI Air Permit Application for Kilgore Company’s Benjamin Pit Christine, On February 2, 2022, a Notice of Intent (NOI) air permit application was submitted for Kilgore Company’s (Kilgore’s) request to alter current operations at its Benjamin Pit in Benjamin, Utah, Utah County. After review of the submitted NOI air permit application, several questions were issued on February 17, 2022. This memorandum addresses those questions, with each question given in italics, below, and the response given immediately thereafter. Please do not hesitate to contact me with any questions that arise due to the contents of this response. Chase Peterson Trinity Consultants Kilgore’s response to the questions issued by the Utah Division of Air Quality (UDAQ) have been addressed as follows: 1. In Table C-12, the PM10 emission factors for the screening operation are all 1.90E-04. However, on the previous page in Table C-11, the emission factors for secondary and tertiary screening are significantly more. If I incorporate the correct emission factors, I get a value closer to 1.5 tpy of P1M10 instead of the 1.01 tpy on the NOI. The Secondary Triple-Deck Screen and the Tertiary Triple-Deck Screen should implement the corresponding PM10 emission factors (3.70E-04 and 7.40E-04 tons per year [tpy], respectively) for their operations. This changes the PM10 emissions from 18.49 tpy of PM10 and 15.44 tpy of Fugitive PM10, to 18.77 tpy of PM10 and 15.72 tpy of Fugitive PM10. Please see the updated Table C-12 in Appendix A of this memo, which implements the correct emission factors. Please note that the correct emission factors were used in the modeling analysis that was submitted to UDAQ; therefore, the modeling analysis and results remain unchanged. 2. On Form 15, it was indicated that the storage pile size was to increase by 3 acres. In table C-13, it states a new stockpile area of 6 acres. Please advise which one is correct. Storage pile area will increase by six (6) acres to a total of 18 acres. Please see Appendix B for an updated Form 15. March 11, 2022 Response to UDAQ’s Questions Page 2 of 8 3. In Table C-41 for the Drilling and Blasting Calculations, it is stated that emission factors for blasting for NOx and CO were taken from AP-42 13.3-1. On the NOI, the NOx EF is listed as 1.6 lb/ton and the CO EF is listed as 40.64 lb/ton. From AP-42, it states the NOx EF is 17 lb/ton and the CO EF is 67 lb/ton. This results in a 1-2 ton/yr difference for each pollutant. I would assume the values should match AP-42 as there is no control for blasting. The footnotes for the drilling and blasting emission factors should be as follows: ► NOX – The average of measurements from “NOX Emissions from Blasting Operations in Open-Cut Coal Mining” by Moetaz I. Attalla, Stuart J. Day, Tony Lange, William Lilley, and Scott Morgan (2008). ► CO – The average of measurements in “Factors Affecting ANFO Fumes Production” by James H. Rowland III and Richard Mainiero (2001). ► SO2 – Based on a diesel sulfur content of 15 ppm, assuming complete conversion to SO2. The sources for the NOX and CO emission factors can be provided upon request. MEMORANDUM 4525 Wasatch Blvd, Ste 200, Salt Lake City, UT 84124 P 801.272.3000 / F 801.272.3040 Appendix A. Updated Emissions Calculations Table C-8. Facility-Wide Emissions Emissions (tpy) PM10 PM10 (Fugitive) PM2.5 NOX CO SO2 VOC CO2e Site-wide PTE 18.77 15.72 7.72 4.44 19.22 7.25 6.21 3,041.59 Permitted Emissions 12.80 NA 5.43 6.41 16.29 4.95 5.17 5,241.00 Site-wide PTE Increase 5.97 -- 2.29 (-1.97) 2.93 2.30 1.04 (-2,199.41) Project Production Increase 5.04 4.52 2.01 1.18 3.38 1.16 1.03 430.58 Results of Emission Factor Adjustments to Existing Sources 0.93 -- 0.28 (-3.15) (-0.45) 1.14 0.01 (-2,629.99) Major Source Thresholds1,2 70 NA 70 70 100 70 70 NA Threshold Exceeded? No NA No No No No No No Modeling Limits3 15 5 No Limit 40 100 40 No Limit No Limit Threshold Exceeded? No NA No No No No No No 1. The Benjamin Pit is located in Utah County, which is in serious nonattainment for PM2.5 and marginal nonattainment for ozone. Values are per UAC R307-403-5(2)(b)(ii). 2. Ammonia emissions were considered for the Benjamin Pit's facility-wide emissions; however, these emissions are not applicable. 3. Per Emissions Impact Assessment Guidelines published by UDAQ. March 11, 2022 Response to UDAQ’s Questions Page 4 of 8 Table C-9. Annual Potential Emissions Increase Summary Process PM10 (tpy) PM2.5 (tpy) NOX (tpy) CO (tpy) SO2 (tpy) VOC (tpy) CO2e (tpy) Proposed Project Emissions Crushing and Screening Operations 1.29 0.24 0.00 0.00 0.00 0.00 0.00 Stockpiles and Disturbed Grounds 6.04 3.46 0.00 0.00 0.00 0.00 0.00 Bulldozers & Drops 1.37 0.29 0.00 0.00 0.00 0.00 0.00 Roads 6.92 0.69 0.00 0.00 0.00 0.00 0.00 Tanks 0.00 0.00 0.00 0.00 0.00 0.06 0.00 Silos 0.14 0.14 0.00 0.36 0.00 2.15 -- Hot Oil Heater 0.03 0.02 0.55 0.05 0.00 0.00 181.91 Drilling and Blasting 0.11 0.01 0.11 2.56 0.00 0.00 -- Drum-Mix Dryer 2.88 2.88 3.78 16.25 7.25 4.00 2,859.68 Total Potential Emissions (tpy) 18.77 7.72 4.44 19.22 7.25 6.21 3,041.59 Table C-12. Annual Aggregate Processed Equipment / Activity Source Description Number of Units or Drop Points Throughput Percent Potential Annual Throughput Controls 1 Emission Factor (lb/ton) Daily PTE Emissions (lb/day) Annual PTE Emissions (tpy)1 (%) (tpy) PM10 PM2.5 PM10 PM2.5 PM10 PM2.5 Primary Crushing Primary Jaw Crusher 1 100% 800,000 Wet Suppression 1.35E-04 2.04E-05 0.30 0.04 0.05 8.18E-03 Secondary Crushing Secondary Cone Crusher 1 70% 560,000 Wet Suppression 2.70E-04 4.09E-05 0.41 0.06 0.08 1.14E-02 Tertiary Crushing Tertiary VSI Crusher 1 35% 280,000 Wet Suppression 5.40E-04 1.00E-04 0.41 0.08 0.08 1.40E-02 Conveyor Transfer Feeder 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 0.03 0.02 5.20E-03 Primary Screening Primary Triple-Deck Screen 1 100% 800,000 Wet Suppression 1.90E-04 5.00E-05 0.42 0.11 0.08 0.02 March 11, 2022 Response to UDAQ’s Questions Page 5 of 8 Equipment / Activity Source Description Number of Units or Drop Points Throughput Percent Potential Annual Throughput Controls 1 Emission Factor (lb/ton) Daily PTE Emissions (lb/day) Annual PTE Emissions (tpy)1 (%) (tpy) PM10 PM2.5 PM10 PM2.5 PM10 PM2.5 Secondary Screening Secondary Triple-Deck Screen 1 75% 600,000 Wet Suppression 3.70E-04 5.00E-05 0.61 0.08 0.11 1.50E-02 Tertiary Screening Tertiary Triple-Deck Screen 1 105% 840,000 Wet Suppression 7.40E-04 5.00E-05 1.70 0.12 0.31 2.10E-02 Conveyor Transfer Conveyor AGG1 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 0.03 0.02 5.20E-03 Conveyor Transfer Conveyor AGG2 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 0.03 0.02 5.20E-03 Conveyor Transfer Conveyor AGG3 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 0.02 5.20E-03 Conveyor Transfer Conveyor AGG4 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 0.03 0.02 5.20E-03 Conveyor Transfer Conveyor AGG5 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 0.02 5.20E-03 Conveyor Transfer Conveyor AGG6 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG7 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG8 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG9 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG10 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG11 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG12 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 March 11, 2022 Response to UDAQ’s Questions Page 6 of 8 Equipment / Activity Source Description Number of Units or Drop Points Throughput Percent Potential Annual Throughput Controls 1 Emission Factor (lb/ton) Daily PTE Emissions (lb/day) Annual PTE Emissions (tpy)1 (%) (tpy) PM10 PM2.5 PM10 PM2.5 PM10 PM2.5 Conveyor Transfer Conveyor AGG13 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG14 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG15 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG16 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG17 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG18 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG19 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG20 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG21 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG22 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG24 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor AGG25 1 100% 800,000 Wet Suppression 4.60E-05 1.30E-05 0.10 2.85E-02 1.84E-02 5.20E-03 Conveyor Transfer Conveyor HMA1 1 73% 183,530 Wet Suppression 4.60E-05 1.30E-05 0.02 6.54E-03 4.22E-03 1.19E-03 Conveyor Transfer Conveyor HMA2 1 73% 183,530 Wet Suppression 4.60E-05 1.30E-05 0.02 6.54E-03 4.22E-03 1.19E-03 March 11, 2022 Response to UDAQ’s Questions Page 7 of 8 Equipment / Activity Source Description Number of Units or Drop Points Throughput Percent Potential Annual Throughput Controls 1 Emission Factor (lb/ton) Daily PTE Emissions (lb/day) Annual PTE Emissions (tpy)1 (%) (tpy) PM10 PM2.5 PM10 PM2.5 PM10 PM2.5 Conveyor Transfer Conveyor HMA3 1 73% 183,530 Wet Suppression 4.60E-05 1.30E-05 0.02 6.54E-03 4.22E-03 1.19E-03 Conveyor Transfer Conveyor HMA4 1 73% 183,530 Wet Suppression 4.60E-05 1.30E-05 0.02 6.54E-03 4.22E-03 1.19E-03 Conveyor Transfer Conveyor HMA5 1 20% 50,000 Wet Suppression 4.60E-05 1.30E-05 0.01 1.78E-03 1.15E-03 3.25E-04 Conveyor Transfer Conveyor HMA6 1 20% 50,000 Wet Suppression 4.60E-05 1.30E-05 0.01 1.78E-03 1.15E-03 3.25E-04 Tertiary Screening Scalping Screen 1 100% 250,000 Wet Suppression 7.40E-04 5.00E-05 0.51 3.42E-02 9.25E-02 6.25E-03 Total Emissions: 7.09 1.30 1.29 0.24 MEMORANDUM 4525 Wasatch Blvd, Ste 200, Salt Lake City, UT 84124 P 801.272.3000 / F 801.272.3040 Appendix B. UDAQ Form 15 MODELING REPORT PM10 24-hour NAAQS and NO2 1-hr and Annual NAAQS / Modeling Report Kilgore Companies / Benjamin Pit Prepared By: TRINITY CONSULTANTS 4525 Wasatch Boulevard, Suite 200 Salt Lake City, UT 84124 (801) 272-3000 For: Kilgore Companies 7057 W 2100 S Salt Lake City, UT 84124 February 2022 Project: 214502.0039 Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants i TABLE OF CONTENTS 1. INTRODUCTION 1-1 1.1 General Information ................................................................................................... 1-1 1.2 Project Scope .............................................................................................................. 1-1 1.3 Plant Layout ................................................................................................................ 1-2 2. AIR DISPERSION MODELING DESCRIPTION 2-1 2.1 Model Selection ........................................................................................................... 2-1 2.2 Meteorological Data .................................................................................................... 2-1 2.3 Terrain Elevations ....................................................................................................... 2-1 2.4 Receptors .................................................................................................................... 2-1 2.5 UTM Coordinate System .............................................................................................. 2-3 2.6 Building Downwash .................................................................................................... 2-3 3. NO2 SOURCE PARAMETERS AND EMISSION RATES 3-1 3.1 NO2 Point Source Parameters and Emission Rates ..................................................... 3-1 3.1.1 Combustion Equipment Modeling Parameters and Emission Rates ................................ 3-1 3.2 NO2 Volume Source Parameters and Emission Rates.................................................. 3-1 3.2.1 Blasting Modeling Parameters and Emission Rates ....................................................... 3-1 3.3 Nearby NO2 Sources - Emission Rates ........................................................................ 3-2 4. PM10 SOURCE PARAMETERS AND EMISSION RATES 4-2 4.1 PM10 Volume Source Parameters and Emission Rates ................................................ 4-2 4.1.1 Aggregate Material Handling Modeling Parameters and Emission Rates ......................... 4-2 4.1.2 HMA Plant Operating Parameters and Emission Rates .................................................. 4-2 4.1.3 Haul Road Modeling Parameters and Emission Rates ................................................... 4-2 4.1.4 Drilling and Blasting .................................................................................................. 4-3 4.2 PM10 Area Source Parameters and Emission Rates ..................................................... 4-4 4.2.1 Stockpile Erosion and Disturbed Ground Modeling Parameters and Emission Rates ........ 4-4 4.2.2 Bulldozer Modeling Parameters .................................................................................. 4-4 4.3 Nearby PM10 Sources - Emission Rates ....................................................................... 4-5 5. NO2 MODELING ANALYSIS 5-2 5.1 NO2 Special Processing ............................................................................................... 5-2 5.2 Blasting Location Screening Analysis ......................................................................... 5-2 5.3 Background NO2 Concentrations ................................................................................ 5-2 5.4 Modeled NO2 Concentration ........................................................................................ 5-3 5.5 NO2 NAAQS Analysis Results ....................................................................................... 5-3 6. PM10 MODELING ANALYSIS 6-4 6.1 Blasting Location Screening Analysis ......................................................................... 6-4 6.2 Background PM10 Concentrations ............................................................................... 6-4 6.3 Modeled PM10 Concentration ...................................................................................... 6-4 6.4 24-Hour PM10 NAAQS Analysis Results ....................................................................... 6-5 APPENDIX A. BENJAMIN PIT MODELING PARAMETERS AND EMISSION RATES A-1 APPENDIX B. BLASTING SCREENING MODEL RESULTS B-1 Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 1-1 1. INTRODUCTION 1.1 General Information Kilgore Companies (Kilgore) is a full-scale construction company that offers paving and construction services, as well as ready-mix concrete and aggregates. Kilgore is proposing to increase its crushing and screening aggregate operations and its hot-mix asphalt (HMA) production operations at their Benjamin, Utah pit in Utah County (Benjamin Pit). Kilgore is submitting a Notice of Intent (NOI) air quality permit application to the Utah Division of Air Quality (UDAQ) in conjunction with this modeling report to obtain a modified approval order (AO) for the Benjamin Pit. Utah County is currently classified as a nonattainment area of the National Ambient Air Quality Standards (NAAQS) for particulate matter (PM) with an aerodynamic diameter of less than 2.5 microns (PM2.5) and 2015 8-hour ozone; it is in attainment for all other criteria pollutants. Oxides of nitrogen (NOX), sulfur dioxide (SO2), volatile organic compounds (VOCs), and ammonia are considered precursors to PM2.5 in Utah. This modeling protocol and report outline the methodology that Kilgore has used in conducting air dispersion modeling. It also describes the results to demonstrate compliance with the NAAQS for one (1)- hour and annual NO2 and 24-hour PM10 at the Benjamin Pit. Dispersion modeling has been conducted in accordance with R307-410-3 and 40 Code of Federal Regulations (CFR) Part 51, Appendix W Guideline on Air Quality Models. 1.2 Project Scope The Benjamin Pit consists of an aggregate mine with aggregate crushing and screening (C&S) operations, as well as an HMA-producing facility. Both the throughput of processed aggregate and HMA product will be increased as part of this project. The C&S operations are comprised of various crushers, screens, conveyors, and stackers, and result in various stockpiles; the C&S operations do not contribute to NO2 air dispersion modeling, as no NOX emissions result from the facility. The source of NO2 on site is the HMA facility, which is comprised of various silos, storage tanks, a heater, a dryer, a mixer, a screen, hopper bins, and conveyors. Specifically, it is the heater, dryer, and mixer that produce NO2 through combustion. Additionally, onsite blasting produces short term NO2 impacts from the explosive combustion. Equipment included in the 1-hour and annual NO2 modeling analysis of the Benjamin Pit are as follows: ► Hot Oil Heater; ► HMA Dryer/Mixer; and ► Blasting. Equipment included in the annual PM10 modeling analysis of the Benjamin Pit are as follows: ► Crushers and screens; ► Conveyors and stackers; ► Drilling and blasting (not concurrent); ► HMA mixer/dryer; ► Hot oil heater; and ► Supporting Operations: • Haul truck traffic; • Bulldozing; Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 1-2 • Stockpiles and disturbed grounds; • Front-end loader operation; and ► Blasting. 1.3 Plant Layout The general facility layout is shown in Figure 1-1, below. Figures 1-2 and 1-3, also below, present a basic layout of the HMA facility at the Benjamin Pit. Aggregate and RAP are loaded into bins and conveyed to the aggregate drum dryer and drum mixer. Lime and fly ash are unloaded from their silos into the drum dryer and drum mixer as well. Anti-strip and AC oil, both HMA agents, are added to the drum and mixed with the aggregate, RAP, lime, and fly ash to form HMA product. The drying and mixing processes are controlled by a baghouse. HMA product is conveyed into asphalt silos where it is then loaded into asphalt trucks to be hauled off site. Figure 1-1. Benjamin Site Plan Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 1-3 Figure 1-2. Benjamin Pit Site Plan Figure 1-2. Process Flow Diagram of the HMA Facility at the Benjamin Pit. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 1-4 Figure 1-4, below, presents a detailed layout of the C&S circuit at the Benjamin Pit. Drilling and blasting operations loosen aggregate from the mine area, where it is then moved by bulldozer and loaded by a front- end loader into the C&S primary feeder. Mined aggregate is then fed into the crushing and screening operations where it is crushed, screened, and stacked into stockpiles. Haul trucks are loaded by a front-end loader to haul trucks which carry product off-site. Figure 1-4. Crushing and Screening Operations at the Benjamin Pit. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 2-1 2. AIR DISPERSION MODELING DESCRIPTION This section describes the air quality dispersion modeling analysis performed to estimate the ambient air impacts of Kilgore’s operation of the Benjamin Pit. All modeling results were compared to both the NO2 NAAQS for the 1-hour and annual averaging period and the PM10 NAAQS for the 24-hour averaging period. The objective of the NAAQS analysis is to demonstrate through air quality dispersion modeling that emissions from the Benjamin Pit do not cause or contribute to an exceedance of the 1-hour/annual NO2 NAAQS or 24-hour PM10 NAAQS in ambient air. No nearby offsite area sources were included, as they were not required. Dispersion Modeling was conducted in accordance with R307-410-3 and 40 CFR Part 51, Appendix W Guideline on Air Quality Models. 2.1 Model Selection Near-field dispersion modeling was performed using the latest version of the AERMOD modeling system, version 19191, which is an EPA approved, steady-state Gaussian mathematical plume model. AERMOD is composed of three (3) modular components: AERMAP, the terrain preprocessor that characterizes the terrain and generates source and receptor elevations and surrounding hill height scales; AERMET, the meteorological preprocessor that processes raw surface and upper air meteorological observations for use by AERMOD; and AERMOD, the control module and modeling processor. 2.2 Meteorological Data Meteorological data used in the dispersion modeling analysis was processed and provided by UDAQ. Data consists of five (5) individual years (2004 through 2008) of National Weather Service (NWS) surface data collected at UDAQ’s Spanish Fork station in Utah that were then concatenated into a five (5)-year file. Concurrent upper air observations used in AERMET were obtained from the Salt Lake City Airport. 2.3 Terrain Elevations Terrain elevations for the Benjamin Pit’s sources, receptors and buildings were determined using National Elevation Dataset (NED), the primary elevation data product of the United States Geologic Survey (USGS).1 NED data are distributed in geographic coordinates in units of decimal degrees, and in conformance with the North American Datum of 1983 (NAD 83). The NED used for this analysis is at a resolution of 1/3 arc- second (about 10 meter) grid spacing. Elevations were converted from the NED grid spacing to the air dispersion model receptor spacing using the AERMOD preprocessor, AERMAP version 18081. All data obtained from the NED files was checked for completeness and spot-checked for accuracy. 2.4 Receptors A modeling domain was developed for the near-field analyses to encompass the location of the maximum modeled concentration from Kilgore’s sources. Discrete receptor locations in AERMOD were based on UTM coordinates in the NAD83 datum, Zone 12N. An initial modeling grid extending a minimum of 3.0 kilometers from the facility center was established. The receptor grid was developed to ensure that maximum pollutant concentrations were captured by the model. The facility boundary is based on an amended version of the existing facility boundary. The revised boundary accounts for an expansion of the facility to the north and west. The ambient air boundary will extend beyond the current Division of Oil, Gas and Mining (DOGM) boundary. Onsite operations will be constrained to the DOGM boundary, but the ambient air boundary was 1 NED data obtained at https://viewer.nationalmap.gov/basic/#/ downloaded December 23, 2020. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 2-2 extended by an additional 120-200 ft on the north and west sides of the facility. This additional property is already legally controlled by Kilgore and the access control will be achieved via signage and security patrol and review. The model receptors consisted of boundary receptors, gridded receptors, and roadway receptors with the following spacing: ► The ambient air boundary was placed at the facility property line and consists of discrete receptors placed at 25-meter intervals. ► The fine grid contains 25-meter spaced receptors extending to 500 meters from the boundary of the facility. ► The medium grid contains 50-meter spaced receptors extending to 750 meters from the boundary of the facility. ► The coarse grid contains 150-meter spaced receptors extending to 2.5 kilometers from the boundary of the facility. Figure 2-1 and Figure 2-2 below show the ambient air boundary receptors (shown in purple below), roadway receptors (yellow), and gridded offsite receptors (yellow). Figure 2-1. Boundary Receptors. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 2-3 Figure 2-2. Fine, Medium, and Coarse Grid and Boundary Receptors 2.5 UTM Coordinate System In all modeling analyses input and output data files, the locations of emission sources, structures, and receptors were represented in the Universal Transverse Mercator (UTM) coordinate system and based on NAD83. In this grid, the world is divided into 60 north-south zones, each covering a strip 6° wide in longitude. The general area of the site is located in UTM Zone 12N. In each UTM Zone, coordinates are measured north and east in meters. The northing values are measured continuously from zero at the equator, in a northerly direction. A central meridian through the middle of each 6° zone is assigned an easting value of 500,000 meters. Grid values to the east of this central meridian, as in the case of the site, are greater than 500,000 meters. 2.6 Building Downwash The emission sources were evaluated in terms of their proximity to nearby structures. The Benjamin Pit is free of structures that would have the potential to induce downwash. A downwash evaluation is not included in this analysis. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 3-1 3. NO2 SOURCE PARAMETERS AND EMISSION RATES 3.1 NO2 Point Source Parameters and Emission Rates Physical parameters for all modeled point sources were determined per manufacturer specification sheets. The NO2 point sources at the Benjamin Pit consist of one (1) Hot Oil Heater and one (1) Drum-Mix Dryer. All point sources require release height, stack temperature, stack velocity, and stack diameter. All inputs for stack source parameters can be seen in Appendix A of this modeling analysis. 3.1.1 Combustion Equipment Modeling Parameters and Emission Rates The modeled point sources of combustion at the Benjamin Pit consist of the following equipment and their release parameters. Table 3-1. Release Parameters for NO2 Point Sources Unit Source Description UTM X (m) UTM Y (m) Elevation (m) Stack Height (m) Stack Temp. (K) Stack Velocity (m/s) Stack Diameter (m) Hot Oil Heater Heater 431,368.2 4,438,996.6 1,469.70 9.14 605 6.58 0.20 Drum-Mix Dryer Dryer/Mixer 431,359.8 4,439,054.8 1,468.34 9.14 505 0.16 1.32 The Benjamin Pit emissions calculations and modeling analysis were conducted using a 40,000 tons per year (tpy) increase in annual HMA throughput. A maximum heat input of 0.25 MMBtu/hr is given for the Hot Oil Heater. A maximum hourly throughput of 400 tons per hour (tph) was assumed for modeling of the Drum- Mix Dryer. Modeling parameters for all point sources and emission rates can be found in Appendix A, Table A-1. 3.2 NO2 Volume Source Parameters and Emission Rates 3.2.1 Blasting Modeling Parameters and Emission Rates The Benjamin Pit mining operations consist of drilling holes for packing explosives in and then blasting those explosives to loosen the material to be handled by bulldozers and front-end loaders. Blasting operations are characterized by the following in the modeling: ► Blasting operations are limited to between 10:00 am and 2:00 pm daily. ► No more than 6,262 ft2 of surface area may be blasted on any one day. The blasting plume height and width were originally based on the U.S. EPA Open Burn/Open Detonation Dispersion Model (OBODM). OBODM was applied to the designed blasting at the Benjamin Pit and calculated a plume width and height of 21.1 meters. Per previous requests by UDAQ for similar operations, the NO2 modeling analysis was conducted with a 50 ft plume height. The modeled volume sources at the Benjamin Pit consist of the following equipment and their release parameters. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 3-2 Table 3-2. Release Parameters for NO2 Volume Sources Unit Source Description UTM X (m) UTM Y (m) Elevation (m) Release Height (m) Initial Lateral Dimension (σy) Initial Vertical Dimension (σz) Blasting Worst Case (1-hr and annual) 430,893.68 4,439,051.27 1,559.16 7.62 9.81 7.09 3.3 Nearby NO2 Sources - Emission Rates No nearby sources of NO2 were required for this air dispersion analysis. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 4-2 4. PM10 SOURCE PARAMETERS AND EMISSION RATES 4.1 PM10 Volume Source Parameters and Emission Rates Aggregate crushing and screening, material handling, raw material and product loading, customer truck export, drilling, and blasting were all modeled as volume sources. All volume sources require release height, initial lateral dimension, initial vertical dimension, and emission rate as inputs to characterize the sources. This section explains the methodology to obtain the modelling parameters required for volume sources. All inputs for volume source parameters can be seen in Appendix A of this modeling analysis. 4.1.1 Aggregate Material Handling Modeling Parameters and Emission Rates The emissions from screening, crushing and associated material transfers were modeled as various volume sources and based on the dimensions of equipment. To be conservative and representative of the source, the initial lateral dimension of the single volume source was the smallest width of the unit divided by 4.3, the initial vertical dimension was the height from ground level to the highest point on the screen divided by 4.3.2 The release height of the single volume source was half of the height (center of the volume source). The Benjamin Pit emissions calculations and modeling analysis were conducted using a 200,000 tons per year (tpy) increase in annual throughput, for a total of 800,000 tpy. A maximum hourly throughput of 800 tons per hour (tph) was assumed for modeling of the primary feeder, and the remaining throughput of equipment is based on the expected percentage of material associated with each piece of equipment following estimated material splits. Modeling parameters for all fugitive material handling emission and emission rates can be found in Appendix A. 4.1.2 HMA Plant Operating Parameters and Emission Rates The emissions sources associated with the HMA Plant were modeled based on emissions parameters as point and volume sources as appropriate in their respective geographic locations based on current plant operations. Additionally, based on business needs, the operation of the HMA Plant and associated facility activities are not operational during January and February of each year. This operational constraint has been included in the model using month of year variable emissions rates. Modeling parameters for all HMA Plant and associated process emission and emission rates can be found in Appendix A. 4.1.3 Haul Road Modeling Parameters and Emission Rates The Benjamin Pit has both paved and unpaved portions of road on which customer trucks travel to retrieve and haul aggregate off site, to retrieve and haul HMA off site, and to bring raw materials on site for HMA production. Guidance from the Haul Road Workgroup Final Report Submission to EPA-OAQPS Memo by Tyler Fox on March 2, 2012, was used to determine the modeling parameters of this haul road. The adjusted road width, release height and emission rates are required volume source inputs for the road. The release height was half the top of the plume height, and the plume height was defined as 1.7 times the 2 Table 3-1 of AERMOD User’s Guide, for single volume source the initial lateral dimension is determined as length of side divided by 4.3. In general, a smaller distance will produce a more conservative concentration. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 4-3 vehicle height.3 Customer trucks were modeled applying a vehicle height of 3.0 m. The vehicle width plus 6.0 m was applied as the width of the plume, also known as the adjusted vehicle width. The Benjamin Pit haul roads are wide enough for two lanes of travel, but haul truck travel frequency will be sparce enough that plumes from multiple trucks will not regularly combine. Therefore, the single lane calculation was used for development of haul road volume source parameters. Applying the adjusted vehicle width and adjacent option, several volume sources were generated which include the emission rate evenly divided between each volume source of the specified road. The initial lateral dimension, initial vertical dimension, and release height for each volume source within the haul road were all identical. The initial lateral dimension was calculated for use in AERMOD as the width of the plume (or adjusted vehicle width) divided by a factor of 2.15. The initial vertical dimension was calculated in AERMOD as the height of the plume divided by a factor of 2.15. The height of the plume was 1.7 times the truck height. The volume sources were spaced based on the “Adjacent” option, indicating they were spaced according to the adjusted vehicle width (i.e., the “adjusted vehicle width” defines the width of each volume source within a roadway and is also the distance between each volume source). Truck traffic at the Benjamin Pit will consist of customer trucks retrieving and hauling both processed aggregate and HMA off site, as well as hauling raw materials on site. There are two (2) primary haul roads; one (1) that services the C&S portion of the facility and one (1) that services the HMA portion of the facility. The entrance road for both portions of the facility is paved. The average vehicle weight was determined by Kilgore-provided average weights based on the mass of empty and filled trucks. Haul road modeling parameters and emissions rates can be found in Appendix A of this modeling analysis. 4.1.4 Drilling and Blasting The Benjamin Pit mining operations consist of drilling holes for packing explosives in and then blasting those explosives to loosen the material to be handled by loaders. Although, the series of events typically consist of drilling holes in the days leading up to a blast day and then on a day that blasting occurs, no drilling occurs, for conservatism in the analysis drilling and blasting in single day was included. Modeled constraints to the PM10 drilling and blasting are characterized by the following: ► Drilling emissions are limited to between 7:00 am and 5:00 pm daily. ► No more than 6,262 ft2 of surface area may be blasted on any one day. ► The emissions associated with blasting have been assumed to occur within a one (1)-hour blasting window from 1:00 - 2:00 pm, the time during the approved blasting window with highest hourly impacts. The drilling plume height and width are based on engineering estimates of typical values for drilling operations at similar mines. The blasting plume height and width were originally based on the U.S. EPA Open Burn/Open Detonation Dispersion Model (OBODM). OBODM was applied to the designed blasting at the Benjamin Pit and calculated a plume width and height of 21.1 meters. Per previous requests by UDAQ for similar operations, the PM10 modeling analysis was conducted with a 50 ft plume height. The drilling and blasting volume source parameters were all calculated using the same methodology. The release height was set equal to half of the plume height and the initial vertical and horizontal directions were set equal to the plume heights and widths divided by a factor of 4.3. 3 Haul Road Workgroup Final Report Submission to EPA-OAQPS Memo by Tyler Fox on March 2, 2012. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 4-4 4.2 PM10 Area Source Parameters and Emission Rates Aggregate stockpiling, disturbed ground, and bulldozing were modeled as area sources. All area sources require release height, initial lateral dimension, initial vertical dimension, and emission rate as inputs to characterize the sources. This section explains the methodology to obtain the modelling parameters required for volume sources. All inputs for volume source parameters can be seen in Appendix A of this modeling analysis. 4.2.1 Stockpile Erosion and Disturbed Ground Modeling Parameters and Emission Rates There are 12 existing acres of stockpiles and disturbed grounds located at the Benjamin Pit that store crushed stone of varying sizes. Six (6) of those acres of stockpiles and disturbed grounds are being added as part of this project, resulting in a total of 18 acres of stockpiles and disturbed grounds. All stockpiles will be round-shaped on the base and created by conveyor stackers; emissions from these piles were modeled as circular area sources. Release height for each pile was determined to be half of the average height.4 This assumption balances the considerations that wind speed increases with elevation and leads to greater erosion, and the surface area above a certain height decreases as the given height increases. Initial vertical dispersion (sigma z) was the average pile height divided by 4.3.5 The release height for the storage pile is above ground level, and the cavity thickness was considered to represent the entire thickness of the plume. Therefore, the area source was considered an elevated source. A 0.0 m release height and 2.0 m initial vertical dimension was provided for active, disturbed ground to account for any slope variation within the area. The location of the vertices parameters was determined based on a known center point from the C&S operations. Base areas and distances were determined by engineering estimates provided by Kilgore. Piles and disturbed ground associated with the operation of the HMA were not operational during January and February of each year. This operational constraint has been included in the model using month of year variable emissions rates. Stockpile and disturbed grounds modeling parameters and emissions rates are detailed in Appendix A of this modeling analysis. 4.2.2 Bulldozer Modeling Parameters Bulldozer operations occur intermittently throughout the site, however, there primary purpose is to move material from the blast area to the crushing and processing area. As such, bulldozer operations have been modeled as a polygonal area source in the location of primary operations. The release height and emission rates are required input for the bulldozer area source. The release height was half the top of the plume height; and the plume height was defined as 1.7 times the vehicle height.6 The initial vertical dimension was calculated in AERMOD as the height of the plume divided by a factor of 4 According to Section 5.2.7 of "Modeling Fugitive Dust Sources with AERMOD" published by the National Stone, Sand, and Gravel Association (NSSGA). 5 According to Section 5.2.9 of "Modeling Fugitive Dust Sources with AERMOD" published by the National Stone, Sand and Gravel Association (NSSGA). 6 Haul Road Workgroup Final Report Submission to EPA-OAQPS Memo by Tyler Fox on March 2, 2012. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 4-5 2.15, recall the height of the plume was 1.7 times the bulldozer height. The bulldozer was modeled applying a 4 m height. The bulldozer modeling parameters and emission rate are detailed in Appendix A of this modeling analysis. 4.3 Nearby PM10 Sources - Emission Rates No nearby sources were required to be included as part of this air dispersion model. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 5-2 5. NO2 MODELING ANALYSIS The NO2 modeling analysis predicts ambient concentrations of NO2 due to emissions from the Benjamin Pit. The modeling output includes tabulated modeling results as compared to the NO2 1-hour and Annual NAAQS. 5.1 NO2 Special Processing The majority of the oxides of nitrogen (NOX) emissions from air emission sources are in the form of nitric oxide (NO), whereas EPA has established a NAAQS for nitrogen dioxide (NO2). EPA’s “Guideline on Air Quality Models” describes a three-tiered screening approach to calculating NO2 concentrations based on dispersion model predictions of NOX concentrations The three tiers, arranged in order from simplest to most refined, are: • Tier 1 – Assume full conversion of NO to NO2, so that the NOX predicted by AERMOD is 100% NO2. • Tier 2 – Ambient Ratio Method (ARM), where model predicted NOX concentrations are multiplied by a NO2/NOX ambient ratio, derived from ambient monitoring data. • Tier 3 – More detailed methods that account for the plume dispersion and chemistry may be considered on a case-by-case basis, including the Ozone Limiting Method (OLM) and the Plume Volume Molar Ratio Method (PVMRM). For the NAAQS modeling of the Benjamin facility, a Tier 3 methodology utilizing OLM was used for the assessment of NO2 impacts. For the Tier 3 assessment, Ozone data from the Spanish Fork monitor from 2004 through 2008 was utilized. The default ambient NOx/NO2 ratio was maintain. The in-stack ratio for each of the onsite processes was reviewed and was assigned based on previously approved regulatory analyses. 5.2 Blasting Location Screening Analysis Due to the potential for movement of blasting activities throughout the mine site, a modeled assessment of 20 sites around the interior of the facility boundary were tested for maximum impacts concentration impacts. The results of these screening analysis concluded that location three near the southwestern edge of the facility produced the highest impacts associated with NO2 impacts. This location was utilized for the assessment of NAAQs attainment demonstrated in this report. The tabulated results of the location screening are included in Appendix B. 5.3 Background NO2 Concentrations Background concentrations for NO2 for the Benjamin area were developed utilizing a data analysis of ambient monitoring data from the Spanish Fork Monitoring station. The background data consists of design values calculated from data monitored from 2018-2020. The value used in the modeling analysis is the 3- year average of the 98% daily 1-Hr maximum and the three-year average of the annual arithmetic mean respectively. The background concentrations for NO2 are presented in Table 5-1 below. Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 5-3 Table 5-5-1. Background Concentrations Pollutant Form of the Standard Annual Monitored Data (µg/m3) Summary Statistic Design Value (µg/m3) 2018 2019 2020 NO2 1-hour 98th Percentile of Annual Daily Maximum 73 79 72 3-year Average 74.8 NO2 Annual Annual Arithmetic Mean 12.5 13.2 14.6 3-year Average 13.4 5.4 Modeled NO2 Concentration The resulting concentration of NO2 from this air dispersion modeling analysis was compared against the NO2 NAAQS to demonstrate that emissions from the Benjamin Pit do not cause or contribute to an exceedance of the NO2 NAAQS. The primary NAAQS is the maximum concentration ceiling, measured in terms of total concentration of a pollutant in the atmosphere, which define the “level of air quality which the U.S. EPA judges are necessary, with an adequate margin of safety, to protect the public health.”7 The 1-hour NO2 NAAQS requires the 8th highest concentration over the five (5) modeled years be compared to the standard. The annual NO2 NAAQS requires that the 1st highest high concentration over the five (5) modeled years be compared to the standard. The modeled concentration was added to the background concentrations for comparison to the NAAQS. This calculation was completed based on out from the AERMOD modeling system. 5.5 NO2 NAAQS Analysis Results A NAAQS analysis considers the impact from the sources at the Benjamin Pit and background concentrations to yield a total concentration which is then compared to the NAAQS. For 1-hour NO2, that value is 188 µg/m3; for annual NO2, that value is 100 µg/m3. The blasting scenario was determined to be below the 1- hour NO2 NAAQS for blasting emissions beginning after 10:00 am and concluding by 2:00 pm. Therefore, the maximum results from between these hours are reported below and submitted with this report. Table 5-2 presents the model-predicted concentrations from the Benjamin Pit and background concentration, and both the 1-hour and annual NO2 NAAQS comparisons. Table 5-5-2. NO2 NAAQS Compliance Demonstration Operating Scenario Pollutant Averaging Period Model-Predicted Concentration Including Background NAAQS Percent of NAAQS (µg/m3) (µg/m3) (%) Complete Operations NO2 1-hour 185.95 188 98.9 Annual 16.48 100 16.5 In addition to this report, Kilgore is providing the AERMOD Input and Output files for UDAQ’s review. 7 40 CFR 50.2(b). Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 6-4 6. PM10 MODELING ANALYSIS The modeling analysis predicts ambient concentrations of PM10 due to emissions from the Benjamin Pit and surrounding co-contributing sources. The modeling output includes tabulated modeling results as compared to the PM10 24-hour NAAQS. 6.1 Blasting Location Screening Analysis Due to the potential for movement of blasting activities throughout the mine site, a modeled assessment of 20 sites around the interior of the facility boundary were tested for maximum impacts concentration impacts. The results of these screening analysis concluded that location seven near the central western edge of the facility produced the highest impacts associated with PM10 impacts. This location was utilized for the assessment of NAAQs attainment demonstrated in this report. The tabulated results of the location screening are included in Appendix B. 6.2 Background PM10 Concentrations Background concentrations for PM10 for the Benjamin area were developed utilizing a data analysis of ambient monitoring data from the Spanish Fork Monitoring station. The background data consists of monthly tabulated maximums of 24-hour PM10 for the years of 2015-2017. The value used in the modeling analysis is the highest second high (H2H) monthly 24-hour value. The background concentrations used for the modeling are presented in Table 6-1 below. Table 6-6-1. Background Concentrations Year 2015 2016 2017 3 Year Month Max Max Max H2H 1 44.5 57.0 88.0 57.0 2 22.8 66.0 41.0 41.0 3 35.3 25.0 49.0 35.3 4 54.2 17.0 44.0 44.0 5 21.0 20.0 30.0 21.0 6 29.3 29.0 70.0 29.3 7 39.5 29.0 70.0 39.5 8 58.5 42.0 56.0 56.0 9 42.1 46.0 56.0 46.0 10 21.5 64.0 53.0 53.0 11 16.3 46.0 34.0 34.0 12 41.9 49.0 56.0 49.0 6.3 Modeled PM10 Concentration The resulting concentration of PM10 from this air dispersion modeling analysis was compared against the PM10 NAAQS to demonstrate that emissions from the Benjamin Pit do not cause or contribute to an exceedance of the PM10 NAAQS. The primary NAAQS is the maximum concentration ceiling, measured in terms of total concentration of a pollutant in the atmosphere, which define the “level of air quality which the U.S. EPA judges are necessary, with an adequate margin of safety, to protect the public health.”8 The 24- 8 40 CFR 50.2(b). Kilgore Companies | PM10 and NO2 Modeling Analyses Trinity Consultants 6-5 hour PM10 NAAQS requires the 6th highest concentration over the five (5) modeled years be compared to the standard. The modeled concentration was added to the monthly background concentrations for comparison to the NAAQS. This calculation was completed within the AERMOD modeling system. 6.4 24-Hour PM10 NAAQS Analysis Results A NAAQS analysis considers the impact from all sources at the Benjamin Pit and background concentrations to yield a total concentration which is then compared to the NAAQS which, for 24-hour PM10, is 150 µg/m3. The blasting scenario was determined to be below the 24-hour PM10 NAAQS for ongoing operations and blasting emissions beginning after 10:00 am and concluding by 2:00 pm, once daily at the worst-case impact hour. The blasting screening analysis also showed that the emissions occurring at the worst-case impact location comply with the NAAQs suggesting that blasting can occur at varied locations throughout the site without additional impacts. Table 4-2 presents the model-predicted concentrations from the Benjamin Pit and background concentration, and 24-hour PM10 NAAQS comparison. Table 6-2. PM10 24-Hour NAAQS Compliance Demonstration Operating Scenario Pollutant Averaging Period Model-Predicted H6H Concentration Including Background NAAQS Percent of NAAQS (µg/m3) (µg/m3) (%) Complete Operations PM10 24-hour 149.15 150 99.5 In addition to this report, Kilgore is providing the AERMOD Input and Output files for UDAQ’s review. Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-1 APPENDIX A. BENJAMIN PIT MODELING PARAMETERS AND EMISSION RATES Table A-1. Point Source Input Data ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Stack Height (m) Stack Temp (K) Stack Velocity (m/s) Stack Diameter (m) SILO_LM Silo 431375.23 4439065.04 1467.15 3.59E-06 9.140001 361 25.14 1.29 SILO_FA Silo 431363.82 4439014.96 1471.16 5.18E-05 9.140001 361 25.14 1.29 SILO_LD Silo 431395.53 4439037.3 1465.61 0.00211 9.140001 361 25.14 1.29 SILO_OUT Silo 431394.98 4439028.26 1465.42 0.00188 9.140001 361 25.14 1.29 HOH Heater 431368.24 4438996.6 1469.7 0.000984 9.140001 605 6.580002 0.2 DMD Dryer 431359.83 4439054.75 1468.34 0.0827 9.140001 505 0.16 1.32 Table A-2. Circular Area Source Input Data ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s-m2) Release Height (m) Radius (m) Vertices Initial Vertical Dimension (m) DSTGR07 Disturbed Ground 431037.67 4439166.81 1519.16 4.420E-07 0 37.5 20 2 Table A-3. Polygon Area Source Input Data ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s-m2) Release Height (m) Initial Vertical Dimension (m) PILENEW1 New Stockpiles 430956.8 4438832.8 1559.21 2.532E-06 3.05 1.42 PILENEW2 New Stockpiles 431143.8 4439302.7 1491.4 2.532E-06 3.05 1.42 PILEEX01 Existing Stockpiles 431137.8 4439126.7 1500.42 4.615E-06 3.05 1.42 PILEEX02 Existing Stockpiles 431095.3 4439014.6 1517.81 4.615E-06 3.05 1.42 PILEEX03 Existing Stockpiles 431169.3 4438943 1514.82 4.615E-06 3.05 1.42 PILEEX04 Existing Stockpiles 431262.5 4438969 1486.64 4.615E-06 3.05 1.42 PILEEX05 Existing Stockpiles 431322.1 4439165 1473.82 4.615E-06 3.05 1.42 BLLDZR Bull Dozing 431072.7 4439139.7 1509 2.804E-07 3.4 0 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-2 Table A-4. Volume Source Input Data ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) PCR_1 Primary Crusher 431184 4439036.6 1490.72 0.00765 2.286 0.5671 2.1265 SCR_1 Secondary Crusher 431192.4 4439059.8 1490.24 0.0153 2.286 0.4714 2.1265 TCR_1 Tertiary Crusher 431197.1 4439069.8 1490.08 0.0306 2.286 0.2127 2.1265 SCRN_1 Screen 431200.8 4439057.9 1490.09 0.0108 2.1336 0.5671 1.9847 SCRN_2 Screen 431205.9 4439079.2 1490.04 0.02100001 2.1336 0.5671 1.9847 SCRN_3 Screen 431228.2 4439068.9 1489.42 0.042 2.1336 0.5671 1.9847 SCLP_SCR Scalping Screen 431351 4439026 1473.99 0.0373 2.286 0.4253 2.1265 BF_RAP1 Bin Feeder 431345.6 4439045.4 1473.73 0.00909 2.286 0.2127 1.0633 BF_RAP2 Bin Feeder 431347.1 4439041.2 1473.66 0.00909 2.286 0.2127 1.0633 BF_RAP3 Bin Feeder 431348.4 4439037.1 1473.7 0.00909 2.286 0.2127 1.0633 BF_AG1 Bin Feeder 431365.7 4439099.7 1468.21 0.00909 2.286 0.2127 1.0633 BF_AG2 Bin Feeder 431365.9 4439095.3 1467.87 0.00909 2.286 0.2127 1.0633 BF_AG3 Bin Feeder 431366.4 4439091.1 1467.54 0.00909 2.286 0.2127 1.0633 BF_AG4 Bin Feeder 431366.9 4439086.9 1467.45 0.00909 2.286 0.2127 1.0633 BF_AG5 Bin Feeder 431367.6 4439082.6 1467.45 0.00909 2.286 0.2127 1.0633 FEED Aggregate Feeder 431179 4439038 1490.88 0.00261 2.286 0.2127 1.0633 C_AG1 Conveyor 431192 4439034 1490.51 0.00261 1.2192 0.2127 0.2835 C_AG2 Conveyor 431198 4439051 1490.28 0.00261 1.2192 0.2127 0.2835 C_AG3 Conveyor 431197 4439048 1490.33 0.00261 1.2192 0.2127 0.2835 C_AG4 Conveyor 431213 4439042 1489.82 0.00261 1.2192 0.2127 0.2835 C_AG5 Conveyor 431201 4439056 1490.12 0.00261 1.2192 0.2127 0.2835 C_AG6 Conveyor 431198 4439057 1490.18 0.00261 1.2192 0.2127 0.2835 C_AG7 Conveyor 431191 4439058 1490.29 0.00261 1.2192 0.2127 0.2835 C_AG8 Conveyor 431194 4439063 1490.17 0.00261 1.2192 0.2127 0.2835 C_AG9 Conveyor 431205 4439067 1489.98 0.00261 1.2192 0.2127 0.2835 C_AG10 Conveyor 431197 4439070 1490.08 0.00261 1.2192 0.2127 0.2835 C_AG11 Conveyor 431207 4439076 1489.95 0.00261 1.2192 0.2127 0.2835 C_AG12 Conveyor 431210 4439074 1489.91 0.00261 1.2192 0.2127 0.2835 C_AG13 Conveyor 431211 4439077 1489.87 0.00261 1.2192 0.2127 0.2835 C_AG14 Conveyor 431218 4439065 1489.69 0.00261 1.2192 0.2127 0.2835 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-3 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) C_AG15 Conveyor 431225 4439061 1489.49 0.00261 1.2192 0.2127 0.2835 C_AG16 Conveyor 431226 4439063 1489.47 0.00261 1.2192 0.2127 0.2835 C_AG17 Conveyor 431228 4439065 1489.42 0.00261 1.2192 0.2127 0.2835 C_AG18 Conveyor 431228 4439073 1489.4 0.00261 1.2192 0.2127 0.2835 C_AG19 Conveyor 431185 4439036 1490.7 0.00261 1.2192 0.2127 0.2835 C_AG20 Conveyor 431188 4439052 1490.4 0.00261 1.2192 0.2127 0.2835 C_AG21 Conveyor 431192 4439059 1490.26 0.00261 1.2192 0.2127 0.2835 C_AG22 Conveyor 431201 4439081 1490.59 0.00261 1.2192 0.2127 0.2835 C_AG23 Conveyor 431208 4439065 1489.9 0.00261 1.2192 0.2127 0.2835 C_AG24 Conveyor 431228 4439071 1489.43 0.00261 1.2192 0.2127 0.2835 C_AG25 Conveyor 431222 4439061 1489.56 0.00261 1.2192 0.2127 0.2835 C_HMA1 Conveyor 431368 4439074 1467.52 0.00232 1.2192 0.2127 0.2835 C_HMA2 Conveyor 431369 4439065 1467.56 0.00232 1.2192 0.2127 0.2835 C_HMA3 Conveyor 431370 4439053 1468.04 0.00232 1.2192 0.2127 0.2835 C_HMA4 Conveyor 431371 4439045 1468.09 0.00232 1.2192 0.2127 0.2835 C_HMA5 Conveyor 431353 4439026 1473.72 0.00232 1.2192 0.2127 0.2835 C_HMA6 Conveyor 431369.4 4439027.5 1468.26 0.00232 1.2192 0.2127 0.2835 STCK1 Stacker 431198.2 4439099.8 1490.56 0.0409 6.858 0.2127 0.3544 STCK2 Stacker 431245.3 4439078.9 1488.86 0.0409 6.858 0.2127 0.3544 STCK3 Stacker 431243.7 4439068.6 1488.95 0.0409 6.858 0.2127 0.3544 STCK4 Stacker 431239.2 4439060.4 1489.05 0.0409 6.858 0.2127 0.3544 STCK5 Stacker 431220.1 4439050.5 1489.52 0.0409 6.858 0.2127 0.3544 STCK6 Stacker 431239.4 4439040.4 1488.78 0.0409 6.858 0.2127 0.3544 LD1 Loader Drop 431174.6 4439044.1 1490.88 0.0409 3.81 0.5671 1.0633 LD2 Loader Drop 431243.3 4439103.0 1489.36 0.0409 3.81 0.5671 1.0633 LD3 Loader Drop 431280.2 4439159.5 1488.26 0.0409 3.81 0.5671 1.0633 LD4 Loader Drop 431366 4439091 1467.57 0.0364 3.81 0.5671 1.0633 LD5 Loader Drop 431347 4439041 1473.69 0.0364 3.81 0.5671 1.0633 BL_50.07 Blasting 431011.16 4439193.32 1518.13 0.455 7.62 9.8116 7.0884 DRILL07 Drilling 431011.16 4439193.32 1518.13 0.01909999 0.762 5.6092 0.7088 OUTPAD01 Outer Loop, Paved 431500.3 4438990.7 1448.7 0.00046 2.55 6.51 2.37 OUTPAD02 Outer Loop, Paved 431501.3 4438999.6 1448.7 0.00046 2.55 6.51 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-4 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) OUTPAD03 Outer Loop, Paved 431502.2 4439008.6 1448.7 0.00046 2.55 6.51 2.37 OUTPAD04 Outer Loop, Paved 431503.2 4439017.5 1448.5 0.00046 2.55 6.51 2.37 OUTPAD05 Outer Loop, Paved 431504.1 4439026.5 1448.5 0.00046 2.55 6.51 2.37 OUTPAD06 Outer Loop, Paved 431505.1 4439035.4 1448.1 0.00046 2.55 6.51 2.37 OUTPAD07 Outer Loop, Paved 431506.1 4439044.4 1447.7 0.00046 2.55 6.51 2.37 OUTPAD08 Outer Loop, Paved 431507 4439053.3 1446.9 0.00046 2.55 6.51 2.37 OUTPAD09 Outer Loop, Paved 431508.4 4439062.2 1446.1 0.00046 2.55 6.51 2.37 OUTPAD10 Outer Loop, Paved 431510.8 4439070.9 1445.5 0.00046 2.55 6.51 2.37 OUTPAD11 Outer Loop, Paved 431513.2 4439079.5 1445.4 0.00046 2.55 6.51 2.37 OUTPAD12 Outer Loop, Paved 431515.7 4439088.2 1445.4 0.00046 2.55 6.51 2.37 OUTPAD13 Outer Loop, Paved 431518.1 4439096.9 1445.6 0.00046 2.55 6.51 2.37 OUTPAD14 Outer Loop, Paved 431520.5 4439105.5 1445.4 0.00046 2.55 6.51 2.37 OUTPAD15 Outer Loop, Paved 431528 4439110.6 1444.4 0.00046 2.55 6.51 2.37 OUTPAD16 Outer Loop, Paved 431535.6 4439115.2 1443.3 0.00046 2.55 6.51 2.37 OUTPAD17 Outer Loop, Paved 431544.3 4439117.6 1442 0.00046 2.55 6.51 2.37 OUTPAD18 Outer Loop, Paved 431545.3 4439117.9 1441.9 0.00046 2.55 6.51 2.37 OUTPAD19 Outer Loop, Paved 431538 4439114.8 1443 0.00046 2.55 6.51 2.37 OUTPAD20 Outer Loop, Paved 431529.7 4439111.2 1444.2 0.00046 2.55 6.51 2.37 OUTPAD21 Outer Loop, Paved 431524.2 4439104.1 1444.9 0.00046 2.55 6.51 2.37 OUTPAD22 Outer Loop, Paved 431521.4 4439096.1 1445.2 0.00046 2.55 6.51 2.37 OUTPAD23 Outer Loop, Paved 431521.5 4439087.1 1444.8 0.00046 2.55 6.51 2.37 OUTPAD24 Outer Loop, Paved 431521.6 4439078.1 1444.7 0.00046 2.55 6.51 2.37 OUTPAD25 Outer Loop, Paved 431521.8 4439069.1 1444.8 0.00046 2.55 6.51 2.37 OUTPAD26 Outer Loop, Paved 431521.9 4439060.1 1444.9 0.00046 2.55 6.51 2.37 OUTPAD27 Outer Loop, Paved 431522 4439051.1 1445.2 0.00046 2.55 6.51 2.37 OUTPAD28 Outer Loop, Paved 431522.2 4439042.1 1445.4 0.00046 2.55 6.51 2.37 OUTPAD29 Outer Loop, Paved 431522.3 4439033.1 1445.5 0.00046 2.55 6.51 2.37 OUTPAD30 Outer Loop, Paved 431522.4 4439024.1 1445.6 0.00046 2.55 6.51 2.37 OUTPAD31 Outer Loop, Paved 431522.6 4439015.1 1445.8 0.00046 2.55 6.51 2.37 OUTPAD32 Outer Loop, Paved 431522.7 4439006.1 1445.7 0.00046 2.55 6.51 2.37 OUTPAD33 Outer Loop, Paved 431521 4438997.8 1445.8 0.00046 2.55 6.51 2.37 OUTPAD34 Outer Loop, Paved 431515.3 4438990.8 1446.8 0.00046 2.55 6.51 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-5 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) OUTPAD35 Outer Loop, Paved 431509.6 4438983.8 1447.5 0.00046 2.55 6.51 2.37 INPAVD01 Inner Loop, Paved 431500.3 4438990.7 1448.7 0.00025 2.55 6.51 2.37 INPAVD02 Inner Loop, Paved 431501.3 4438999.6 1448.7 0.00025 2.55 6.51 2.37 INPAVD03 Inner Loop, Paved 431502.2 4439008.6 1448.7 0.00025 2.55 6.51 2.37 INPAVD04 Inner Loop, Paved 431503.2 4439017.5 1448.5 0.00025 2.55 6.51 2.37 INPAVD05 Inner Loop, Paved 431504.1 4439026.5 1448.5 0.00025 2.55 6.51 2.37 INPAVD06 Inner Loop, Paved 431505.1 4439035.4 1448.1 0.00025 2.55 6.51 2.37 INPAVD07 Inner Loop, Paved 431506.1 4439044.4 1447.7 0.00025 2.55 6.51 2.37 INPAVD08 Inner Loop, Paved 431507 4439053.3 1446.9 0.00025 2.55 6.51 2.37 INPAVD09 Inner Loop, Paved 431508.4 4439062.2 1446.1 0.00025 2.55 6.51 2.37 INPAVD10 Inner Loop, Paved 431510.8 4439070.9 1445.5 0.00025 2.55 6.51 2.37 INPAVD11 Inner Loop, Paved 431513.2 4439079.5 1445.4 0.00025 2.55 6.51 2.37 INPAVD12 Inner Loop, Paved 431515.7 4439088.2 1445.4 0.00025 2.55 6.51 2.37 INPAVD13 Inner Loop, Paved 431518.1 4439096.9 1445.6 0.00025 2.55 6.51 2.37 INPAVD14 Inner Loop, Paved 431520.5 4439105.5 1445.4 0.00025 2.55 6.51 2.37 INPAVD15 Inner Loop, Paved 431528 4439110.6 1444.4 0.00025 2.55 6.51 2.37 INPAVD16 Inner Loop, Paved 431535.6 4439115.2 1443.3 0.00025 2.55 6.51 2.37 INPAVD17 Inner Loop, Paved 431544.3 4439117.6 1442 0.00025 2.55 6.51 2.37 INPAVD18 Inner Loop, Paved 431545.3 4439117.9 1441.9 0.00025 2.55 6.51 2.37 INPAVD19 Inner Loop, Paved 431538 4439114.8 1443 0.00025 2.55 6.51 2.37 INPAVD20 Inner Loop, Paved 431529.7 4439111.2 1444.2 0.00025 2.55 6.51 2.37 INPAVD21 Inner Loop, Paved 431524.2 4439104.1 1444.9 0.00025 2.55 6.51 2.37 INPAVD22 Inner Loop, Paved 431521.4 4439096.1 1445.2 0.00025 2.55 6.51 2.37 INPAVD23 Inner Loop, Paved 431521.5 4439087.1 1444.8 0.00025 2.55 6.51 2.37 INPAVD24 Inner Loop, Paved 431521.6 4439078.1 1444.7 0.00025 2.55 6.51 2.37 INPAVD25 Inner Loop, Paved 431521.8 4439069.1 1444.8 0.00025 2.55 6.51 2.37 INPAVD26 Inner Loop, Paved 431521.9 4439060.1 1444.9 0.00025 2.55 6.51 2.37 INPAVD27 Inner Loop, Paved 431522 4439051.1 1445.2 0.00025 2.55 6.51 2.37 INPAVD28 Inner Loop, Paved 431522.2 4439042.1 1445.4 0.00025 2.55 6.51 2.37 INPAVD29 Inner Loop, Paved 431522.3 4439033.1 1445.5 0.00025 2.55 6.51 2.37 INPAVD30 Inner Loop, Paved 431522.4 4439024.1 1445.6 0.00025 2.55 6.51 2.37 INPAVD31 Inner Loop, Paved 431522.6 4439015.1 1445.8 0.00025 2.55 6.51 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-6 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) INPAVD32 Inner Loop, Paved 431522.7 4439006.1 1445.7 0.00025 2.55 6.51 2.37 INPAVD33 Inner Loop, Paved 431521 4438997.8 1445.8 0.00025 2.55 6.51 2.37 INPAVD34 Inner Loop, Paved 431515.3 4438990.8 1446.8 0.00025 2.55 6.51 2.37 INPAVD35 Inner Loop, Paved 431509.6 4438983.8 1447.5 0.00025 2.55 6.51 2.37 OUTUND01 Outer Loop, Unpaved 431496.7 4438985.6 1449.2 0.00111 2.55 6.51 2.37 OUTUND02 Outer Loop, Unpaved 431488.3 4438982.3 1450.2 0.00111 2.55 6.51 2.37 OUTUND03 Outer Loop, Unpaved 431479.7 4438981.9 1451.4 0.00111 2.55 6.51 2.37 OUTUND04 Outer Loop, Unpaved 431470.8 4438983.3 1452.7 0.00111 2.55 6.51 2.37 OUTUND05 Outer Loop, Unpaved 431463.1 4438987.5 1453.9 0.00111 2.55 6.51 2.37 OUTUND06 Outer Loop, Unpaved 431456.3 4438993.3 1454.9 0.00111 2.55 6.51 2.37 OUTUND07 Outer Loop, Unpaved 431449.4 4438999.2 1455.9 0.00111 2.55 6.51 2.37 OUTUND08 Outer Loop, Unpaved 431442.5 4439005 1457.2 0.00111 2.55 6.51 2.37 OUTUND09 Outer Loop, Unpaved 431437.9 4439012.2 1458 0.00111 2.55 6.51 2.37 OUTUND10 Outer Loop, Unpaved 431435.6 4439020.9 1459 0.00111 2.55 6.51 2.37 OUTUND11 Outer Loop, Unpaved 431433.2 4439029.6 1459.4 0.00111 2.55 6.51 2.37 OUTUND12 Outer Loop, Unpaved 431430.9 4439038.3 1459.4 0.00111 2.55 6.51 2.37 OUTUND13 Outer Loop, Unpaved 431428.5 4439047 1460.4 0.00111 2.55 6.51 2.37 OUTUND14 Outer Loop, Unpaved 431426.2 4439055.7 1461 0.00111 2.55 6.51 2.37 OUTUND15 Outer Loop, Unpaved 431423.8 4439064.4 1461.5 0.00111 2.55 6.51 2.37 OUTUND16 Outer Loop, Unpaved 431421.5 4439073 1462.3 0.00111 2.55 6.51 2.37 OUTUND17 Outer Loop, Unpaved 431419.1 4439081.7 1463 0.00111 2.55 6.51 2.37 OUTUND18 Outer Loop, Unpaved 431416.8 4439090.4 1463.1 0.00111 2.55 6.51 2.37 OUTUND19 Outer Loop, Unpaved 431412 4439097.6 1463.7 0.00111 2.55 6.51 2.37 OUTUND20 Outer Loop, Unpaved 431405.5 4439103.8 1464 0.00111 2.55 6.51 2.37 OUTUND21 Outer Loop, Unpaved 431398.9 4439110 1464.8 0.00111 2.55 6.51 2.37 OUTUND22 Outer Loop, Unpaved 431394.3 4439114.6 1465.2 0.00111 2.55 6.51 2.37 OUTUND23 Outer Loop, Unpaved 431387.8 4439120.9 1466.2 0.00111 2.55 6.51 2.37 OUTUND24 Outer Loop, Unpaved 431381.4 4439127.1 1467.1 0.00111 2.55 6.51 2.37 OUTUND25 Outer Loop, Unpaved 431374.9 4439133.4 1467.6 0.00111 2.55 6.51 2.37 OUTUND26 Outer Loop, Unpaved 431369.1 4439140.2 1468.2 0.00111 2.55 6.51 2.37 OUTUND27 Outer Loop, Unpaved 431363.4 4439147.2 1468.4 0.00111 2.55 6.51 2.37 OUTUND28 Outer Loop, Unpaved 431357.8 4439154.3 1469 0.00111 2.55 6.51 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-7 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) OUTUND29 Outer Loop, Unpaved 431352.1 4439161.2 1469.6 0.00111 2.55 6.51 2.37 OUTUND30 Outer Loop, Unpaved 431344.3 4439165.7 1470.2 0.00111 2.55 6.51 2.37 OUTUND31 Outer Loop, Unpaved 431336.5 4439170.2 1470.6 0.00111 2.55 6.51 2.37 OUTUND32 Outer Loop, Unpaved 431328.5 4439174.2 1472.1 0.00111 2.55 6.51 2.37 OUTUND33 Outer Loop, Unpaved 431320 4439177.1 1473.4 0.00111 2.55 6.51 2.37 OUTUND34 Outer Loop, Unpaved 431311.5 4439180.1 1474.4 0.00111 2.55 6.51 2.37 OUTUND35 Outer Loop, Unpaved 431303 4439183 1475 0.00111 2.55 6.51 2.37 OUTUND36 Outer Loop, Unpaved 431294.5 4439186 1475.5 0.00111 2.55 6.51 2.37 OUTUND37 Outer Loop, Unpaved 431286 4439188.9 1476.1 0.00111 2.55 6.51 2.37 OUTUND38 Outer Loop, Unpaved 431277.5 4439190.5 1476.7 0.00111 2.55 6.51 2.37 OUTUND39 Outer Loop, Unpaved 431269.1 4439187.2 1477.5 0.00111 2.55 6.51 2.37 OUTUND40 Outer Loop, Unpaved 431260.7 4439184 1478.3 0.00111 2.55 6.51 2.37 OUTUND41 Outer Loop, Unpaved 431256.5 4439182.4 1478.9 0.00111 2.55 6.51 2.37 OUTUND42 Outer Loop, Unpaved 431254.9 4439178.2 1479.2 0.00111 2.55 6.51 2.37 OUTUND43 Outer Loop, Unpaved 431251.6 4439169.8 1479.9 0.00111 2.55 6.51 2.37 OUTUND44 Outer Loop, Unpaved 431248.4 4439161.4 1480.1 0.00111 2.55 6.51 2.37 OUTUND45 Outer Loop, Unpaved 431248.3 4439152.6 1480.8 0.00111 2.55 6.51 2.37 OUTUND46 Outer Loop, Unpaved 431249.2 4439143.6 1482.7 0.00111 2.55 6.51 2.37 OUTUND47 Outer Loop, Unpaved 431250.1 4439134.7 1484.2 0.00111 2.55 6.51 2.37 OUTUND48 Outer Loop, Unpaved 431251 4439125.7 1485.2 0.00111 2.55 6.51 2.37 OUTUND49 Outer Loop, Unpaved 431251.9 4439116.8 1485.8 0.00111 2.55 6.51 2.37 OUTUND50 Outer Loop, Unpaved 431252.8 4439107.8 1486.2 0.00111 2.55 6.51 2.37 OUTUND51 Outer Loop, Unpaved 431253.7 4439098.9 1486.7 0.00111 2.55 6.51 2.37 OUTUND52 Outer Loop, Unpaved 431254.6 4439089.9 1488.1 0.00111 2.55 6.51 2.37 OUTUND53 Outer Loop, Unpaved 431255.5 4439081 1488.3 0.00111 2.55 6.51 2.37 OUTUND54 Outer Loop, Unpaved 431256.4 4439072 1488.5 0.00111 2.55 6.51 2.37 OUTUND55 Outer Loop, Unpaved 431256.4 4439063 1488.6 0.00111 2.55 6.51 2.37 OUTUND56 Outer Loop, Unpaved 431255.8 4439054.1 1488.7 0.00111 2.55 6.51 2.37 OUTUND57 Outer Loop, Unpaved 431255.2 4439045.1 1488.7 0.00111 2.55 6.51 2.37 OUTUND58 Outer Loop, Unpaved 431254.6 4439036.1 1488.9 0.00111 2.55 6.51 2.37 OUTUND59 Outer Loop, Unpaved 431254 4439027.1 1489.2 0.00111 2.55 6.51 2.37 OUTUND60 Outer Loop, Unpaved 431253.4 4439018.1 1489.4 0.00111 2.55 6.51 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-8 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) OUTUND61 Outer Loop, Unpaved 431252.8 4439009.2 1488.7 0.00111 2.55 6.51 2.37 OUTUND62 Outer Loop, Unpaved 431252.4 4439000.2 1488.5 0.00111 2.55 6.51 2.37 OUTUND63 Outer Loop, Unpaved 431252.2 4438991.2 1488.1 0.00111 2.55 6.51 2.37 OUTUND64 Outer Loop, Unpaved 431252 4438982.2 1487.5 0.00111 2.55 6.51 2.37 OUTUND65 Outer Loop, Unpaved 431254.6 4438973.8 1487 0.00111 2.55 6.51 2.37 OUTUND66 Outer Loop, Unpaved 431258.5 4438965.7 1486.5 0.00111 2.55 6.51 2.37 OUTUND67 Outer Loop, Unpaved 431262.6 4438957.7 1486.1 0.00111 2.55 6.51 2.37 OUTUND68 Outer Loop, Unpaved 431269.5 4438952 1485.2 0.00111 2.55 6.51 2.37 OUTUND69 Outer Loop, Unpaved 431276.5 4438946.3 1484.6 0.00111 2.55 6.51 2.37 OUTUND70 Outer Loop, Unpaved 431283.6 4438940.8 1482.6 0.00111 2.55 6.51 2.37 OUTUND71 Outer Loop, Unpaved 431291.6 4438936.7 1480 0.00111 2.55 6.51 2.37 OUTUND72 Outer Loop, Unpaved 431299.6 4438932.6 1479.3 0.00111 2.55 6.51 2.37 OUTUND73 Outer Loop, Unpaved 431307.6 4438928.4 1479.9 0.00111 2.55 6.51 2.37 OUTUND74 Outer Loop, Unpaved 431316.5 4438928.2 1479.7 0.00111 2.55 6.51 2.37 OUTUND75 Outer Loop, Unpaved 431325.5 4438928.5 1477.8 0.00111 2.55 6.51 2.37 OUTUND76 Outer Loop, Unpaved 431334.5 4438928.7 1475.5 0.00111 2.55 6.51 2.37 OUTUND77 Outer Loop, Unpaved 431343.5 4438928.9 1473.8 0.00111 2.55 6.51 2.37 OUTUND78 Outer Loop, Unpaved 431352.5 4438929.2 1472.5 0.00111 2.55 6.51 2.37 OUTUND79 Outer Loop, Unpaved 431361.5 4438929.4 1471.3 0.00111 2.55 6.51 2.37 OUTUND80 Outer Loop, Unpaved 431370.4 4438929.6 1470 0.00111 2.55 6.51 2.37 OUTUND81 Outer Loop, Unpaved 431379.4 4438929.9 1469 0.00111 2.55 6.51 2.37 OUTUND82 Outer Loop, Unpaved 431388.4 4438930.1 1467.7 0.00111 2.55 6.51 2.37 OUTUND83 Outer Loop, Unpaved 431397.4 4438930.4 1465.4 0.00111 2.55 6.51 2.37 OUTUND84 Outer Loop, Unpaved 431406.4 4438930.6 1463.1 0.00111 2.55 6.51 2.37 OUTUND85 Outer Loop, Unpaved 431415.4 4438930.8 1461.6 0.00111 2.55 6.51 2.37 OUTUND86 Outer Loop, Unpaved 431424.4 4438931.1 1459.9 0.00111 2.55 6.51 2.37 OUTUND87 Outer Loop, Unpaved 431435.2 4438931.2 1458.4 0.00111 2.55 6.51 2.37 OUTUND88 Outer Loop, Unpaved 431444.2 4438931.8 1457.1 0.00111 2.55 6.51 2.37 OUTUND89 Outer Loop, Unpaved 431453.2 4438932.4 1456 0.00111 2.55 6.51 2.37 OUTUND90 Outer Loop, Unpaved 431462.1 4438933 1455.3 0.00111 2.55 6.51 2.37 OUTUND91 Outer Loop, Unpaved 431469.1 4438938.6 1455.2 0.00111 2.55 6.51 2.37 OUTUND92 Outer Loop, Unpaved 431476.1 4438944.3 1454 0.00111 2.55 6.51 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-9 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) OUTUND93 Outer Loop, Unpaved 431483 4438950 1452.4 0.00111 2.55 6.51 2.37 OUTUND94 Outer Loop, Unpaved 431490 4438955.8 1450.7 0.00111 2.55 6.51 2.37 OUTUND95 Outer Loop, Unpaved 431495.4 4438962.9 1449.8 0.00111 2.55 6.51 2.37 OUTUND96 Outer Loop, Unpaved 431500.6 4438970.2 1449 0.00111 2.55 6.51 2.37 OUTUND97 Outer Loop, Unpaved 431505.8 4438977.6 1448.2 0.00111 2.55 6.51 2.37 INUNPD01 Inner Loop, Unpaved 431496.7 4438985.6 1449.2 0.00037 2.55 6.51 2.37 INUNPD02 Inner Loop, Unpaved 431488.3 4438982.3 1450.2 0.00037 2.55 6.51 2.37 INUNPD03 Inner Loop, Unpaved 431479.7 4438981.9 1451.4 0.00037 2.55 6.51 2.37 INUNPD04 Inner Loop, Unpaved 431470.8 4438983.3 1452.7 0.00037 2.55 6.51 2.37 INUNPD05 Inner Loop, Unpaved 431463.1 4438987.5 1453.9 0.00037 2.55 6.51 2.37 INUNPD06 Inner Loop, Unpaved 431456.3 4438993.3 1454.9 0.00037 2.55 6.51 2.37 INUNPD07 Inner Loop, Unpaved 431449.4 4438999.2 1455.9 0.00037 2.55 6.51 2.37 INUNPD08 Inner Loop, Unpaved 431442.5 4439005 1457.2 0.00037 2.55 6.51 2.37 INUNPD09 Inner Loop, Unpaved 431437.9 4439012.2 1458 0.00037 2.55 6.51 2.37 INUNPD10 Inner Loop, Unpaved 431435.6 4439020.9 1459 0.00037 2.55 6.51 2.37 INUNPD11 Inner Loop, Unpaved 431433.2 4439029.6 1459.4 0.00037 2.55 6.51 2.37 INUNPD12 Inner Loop, Unpaved 431430.9 4439038.3 1459.4 0.00037 2.55 6.51 2.37 INUNPD13 Inner Loop, Unpaved 431428.5 4439047 1460.4 0.00037 2.55 6.51 2.37 INUNPD14 Inner Loop, Unpaved 431426.2 4439055.7 1461 0.00037 2.55 6.51 2.37 INUNPD15 Inner Loop, Unpaved 431423.8 4439064.4 1461.5 0.00037 2.55 6.51 2.37 INUNPD16 Inner Loop, Unpaved 431421.5 4439073 1462.3 0.00037 2.55 6.51 2.37 INUNPD17 Inner Loop, Unpaved 431419.1 4439081.7 1463 0.00037 2.55 6.51 2.37 INUNPD18 Inner Loop, Unpaved 431416.8 4439090.4 1463.1 0.00037 2.55 6.51 2.37 INUNPD19 Inner Loop, Unpaved 431412 4439097.6 1463.7 0.00037 2.55 6.51 2.37 INUNPD20 Inner Loop, Unpaved 431405.5 4439103.8 1464 0.00037 2.55 6.51 2.37 INUNPD21 Inner Loop, Unpaved 431398.9 4439110 1464.8 0.00037 2.55 6.51 2.37 INUNPD22 Inner Loop, Unpaved 431390.7 4439112.5 1465.6 0.00037 2.55 6.51 2.37 INUNPD23 Inner Loop, Unpaved 431381.7 4439112.3 1466.5 0.00037 2.55 6.51 2.37 INUNPD24 Inner Loop, Unpaved 431372.9 4439111.2 1467.5 0.00037 2.55 6.51 2.37 INUNPD25 Inner Loop, Unpaved 431364.7 4439107.5 1468.6 0.00037 2.55 6.51 2.37 INUNPD26 Inner Loop, Unpaved 431356.8 4439103.4 1469.8 0.00037 2.55 6.51 2.37 INUNPD27 Inner Loop, Unpaved 431352.4 4439095.6 1470.2 0.00037 2.55 6.51 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-10 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) INUNPD28 Inner Loop, Unpaved 431348.3 4439087.6 1470.8 0.00037 2.55 6.51 2.37 INUNPD29 Inner Loop, Unpaved 431346.1 4439078.9 1471.6 0.00037 2.55 6.51 2.37 INUNPD30 Inner Loop, Unpaved 431343.9 4439070.1 1473.5 0.00037 2.55 6.51 2.37 INUNPD31 Inner Loop, Unpaved 431341.8 4439061.4 1474.3 0.00037 2.55 6.51 2.37 INUNPD32 Inner Loop, Unpaved 431339.8 4439052.6 1474.8 0.00037 2.55 6.51 2.37 INUNPD33 Inner Loop, Unpaved 431337.9 4439043.8 1475.3 0.00037 2.55 6.51 2.37 INUNPD34 Inner Loop, Unpaved 431336.6 4439034.9 1475.4 0.00037 2.55 6.51 2.37 INUNPD35 Inner Loop, Unpaved 431335.3 4439026 1475 0.00037 2.55 6.51 2.37 INUNPD36 Inner Loop, Unpaved 431334 4439017.1 1475 0.00037 2.55 6.51 2.37 INUNPD37 Inner Loop, Unpaved 431332.8 4439008.2 1476 0.00037 2.55 6.51 2.37 INUNPD38 Inner Loop, Unpaved 431332 4438999.3 1476.6 0.00037 2.55 6.51 2.37 INUNPD39 Inner Loop, Unpaved 431333.5 4438990.4 1475.6 0.00037 2.55 6.51 2.37 INUNPD40 Inner Loop, Unpaved 431335.1 4438981.6 1474.8 0.00037 2.55 6.51 2.37 INUNPD41 Inner Loop, Unpaved 431335.6 4438978.9 1474.7 0.00037 2.55 6.51 2.37 INUNPD42 Inner Loop, Unpaved 431341.5 4438976.8 1474 0.00037 2.55 6.51 2.37 INUNPD43 Inner Loop, Unpaved 431350 4438973.7 1473 0.00037 2.55 6.51 2.37 INUNPD44 Inner Loop, Unpaved 431358.7 4438972.3 1471.2 0.00037 2.55 6.51 2.37 INUNPD45 Inner Loop, Unpaved 431367.7 4438972.4 1469 0.00037 2.55 6.51 2.37 INUNPD46 Inner Loop, Unpaved 431376.7 4438972.5 1467.7 0.00037 2.55 6.51 2.37 INUNPD47 Inner Loop, Unpaved 431385.7 4438972.6 1466.4 0.00037 2.55 6.51 2.37 INUNPD48 Inner Loop, Unpaved 431385.8 4438972.6 1466.3 0.00037 2.55 6.51 2.37 INUNPD49 Inner Loop, Unpaved 431390.7 4438965.2 1465.3 0.00037 2.55 6.51 2.37 INUNPD50 Inner Loop, Unpaved 431395.7 4438957.7 1464.3 0.00037 2.55 6.51 2.37 INUNPD51 Inner Loop, Unpaved 431400.8 4438950.2 1463.5 0.00037 2.55 6.51 2.37 INUNPD52 Inner Loop, Unpaved 431406 4438942.9 1462.4 0.00037 2.55 6.51 2.37 INUNPD53 Inner Loop, Unpaved 431413.6 4438938.5 1460.9 0.00037 2.55 6.51 2.37 INUNPD54 Inner Loop, Unpaved 431421.9 4438935.1 1459.5 0.00037 2.55 6.51 2.37 INUNPD55 Inner Loop, Unpaved 431435.2 4438931.2 1458.4 0.00037 2.55 6.51 2.37 INUNPD56 Inner Loop, Unpaved 431444.2 4438931.8 1457.1 0.00037 2.55 6.51 2.37 INUNPD57 Inner Loop, Unpaved 431453.2 4438932.4 1456 0.00037 2.55 6.51 2.37 INUNPD58 Inner Loop, Unpaved 431462.1 4438933 1455.3 0.00037 2.55 6.51 2.37 INUNPD59 Inner Loop, Unpaved 431469.1 4438938.6 1455.2 0.00037 2.55 6.51 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-11 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) INUNPD60 Inner Loop, Unpaved 431476.1 4438944.3 1454 0.00037 2.55 6.51 2.37 INUNPD61 Inner Loop, Unpaved 431483 4438950 1452.4 0.00037 2.55 6.51 2.37 INUNPD62 Inner Loop, Unpaved 431490 4438955.8 1450.7 0.00037 2.55 6.51 2.37 INUNPD63 Inner Loop, Unpaved 431495.4 4438962.9 1449.8 0.00037 2.55 6.51 2.37 INUNPD64 Inner Loop, Unpaved 431500.6 4438970.2 1449 0.00037 2.55 6.51 2.37 INUNPD65 Inner Loop, Unpaved 431505.8 4438977.6 1448.2 0.00037 2.55 6.51 2.37 LD_AGB01 Loader to Aggregate Bins 431332.9 4439037.1 1476.3 0.00054 2.55 7.44 2.37 LD_AGB02 Loader to Aggregate Bins 431335.5 4439045.7 1475.7 0.00054 2.55 7.44 2.37 LD_AGB03 Loader to Aggregate Bins 431338 4439054.4 1475 0.00054 2.55 7.44 2.37 LD_AGB04 Loader to Aggregate Bins 431340.6 4439063 1474.6 0.00054 2.55 7.44 2.37 LD_AGB05 Loader to Aggregate Bins 431343.2 4439071.6 1473.6 0.00054 2.55 7.44 2.37 LD_AGB06 Loader to Aggregate Bins 431347.8 4439078.7 1470.8 0.00054 2.55 7.44 2.37 LD_AGB07 Loader to Aggregate Bins 431355.1 4439084 1468.9 0.00054 2.55 7.44 2.37 LD_RPB01 Loader to RAP Bins 431362.2 4438956.9 1470.2 0.00007 2.55 7.44 2.37 LD_RPB02 Loader to RAP Bins 431361.1 4438965.8 1470 0.00007 2.55 7.44 2.37 LD_RPB03 Loader to RAP Bins 431360.2 4438972.7 1470.9 0.00007 2.55 7.44 2.37 LD_RPB04 Loader to RAP Bins 431358.2 4438973.1 1471.5 0.00007 2.55 7.44 2.37 LD_RPB05 Loader to RAP Bins 431349.3 4438974.8 1473.2 0.00007 2.55 7.44 2.37 LD_RPB06 Loader to RAP Bins 431340.5 4438976.5 1474 0.00007 2.55 7.44 2.37 LD_RPB07 Loader to RAP Bins 431337.9 4438977 1474.3 0.00007 2.55 7.44 2.37 LD_RPB08 Loader to RAP Bins 431335.9 4438983.1 1474.8 0.00007 2.55 7.44 2.37 LD_RPB09 Loader to RAP Bins 431333.2 4438991.6 1475.8 0.00007 2.55 7.44 2.37 LD_RPB10 Loader to RAP Bins 431333.6 4439000.5 1476.4 0.00007 2.55 7.44 2.37 LD_RPB11 Loader to RAP Bins 431334.4 4439009.5 1475.6 0.00007 2.55 7.44 2.37 LD_RPB12 Loader to RAP Bins 431335.2 4439018.5 1474.9 0.00007 2.55 7.44 2.37 LD_RPB13 Loader to RAP Bins 431335.9 4439027.4 1475 0.00007 2.55 7.44 2.37 LD_RPB14 Loader to RAP Bins 431336.3 4439031.8 1475.2 0.00007 2.55 7.44 2.37 LD_RPB15 Loader to RAP Bins 431340.4 4439033.9 1474.8 0.00007 2.55 7.44 2.37 LD_RPB16 Loader to RAP Bins 431348.5 4439038 1473.6 0.00007 2.55 7.44 2.37 LD_AGH01 Loader to Agg Haul Trucks (Product) 431237 4438970.4 1486.5 0.00163 2.55 7.44 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-12 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) LD_AGH02 Loader to Agg Haul Trucks (Product) 431242.2 4438977.8 1487.8 0.00163 2.55 7.44 2.37 LD_AGH03 Loader to Agg Haul Trucks (Product) 431247.3 4438985.1 1488.2 0.00163 2.55 7.44 2.37 LD_AGH04 Loader to Agg Haul Trucks (Product) 431252.5 4438992.5 1488.2 0.00163 2.55 7.44 2.37 LD_AGF01 Loader to Agg Feeder 431091.3 4438978.9 1520.3 0.00096 2.55 7.44 2.37 LD_AGF02 Loader to Agg Feeder 431100.3 4438979.8 1518 0.00096 2.55 7.44 2.37 LD_AGF03 Loader to Agg Feeder 431109.2 4438980.7 1515.3 0.00096 2.55 7.44 2.37 LD_AGF04 Loader to Agg Feeder 431118.2 4438981.7 1512.5 0.00096 2.55 7.44 2.37 LD_AGF05 Loader to Agg Feeder 431127.1 4438982.6 1510.2 0.00096 2.55 7.44 2.37 LD_AGF06 Loader to Agg Feeder 431136.1 4438983.5 1508.1 0.00096 2.55 7.44 2.37 LD_AGF07 Loader to Agg Feeder 431145 4438984.4 1506.1 0.00096 2.55 7.44 2.37 LD_AGF08 Loader to Agg Feeder 431154 4438985.3 1505.1 0.00096 2.55 7.44 2.37 LD_AGF09 Loader to Agg Feeder 431162.9 4438986.3 1504.9 0.00096 2.55 7.44 2.37 LD_AGF10 Loader to Agg Feeder 431171.9 4438987.2 1504.8 0.00096 2.55 7.44 2.37 LD_AGF11 Loader to Agg Feeder 431173.9 4438987.4 1504.7 0.00096 2.55 7.44 2.37 LD_AGF12 Loader to Agg Feeder 431174.5 4438994.3 1502.7 0.00096 2.55 7.44 2.37 LD_AGF13 Loader to Agg Feeder 431175.3 4439003.3 1499 0.00096 2.55 7.44 2.37 LD_AGF14 Loader to Agg Feeder 431176 4439012.3 1494.6 0.00096 2.55 7.44 2.37 LD_AGF15 Loader to Agg Feeder 431176.8 4439021.2 1491.1 0.00096 2.55 7.44 2.37 LD_AGF16 Loader to Agg Feeder 431177.6 4439030.2 1490.9 0.00096 2.55 7.44 2.37 LD_AGF17 Loader to Agg Feeder 431177.9 4439034 1490.9 0.00096 2.55 7.44 2.37 LD_AGS01 Loader to Agg Stockpiles 431206.1 4439095.8 1490.9 0.00131 2.55 7.44 2.37 LD_AGS02 Loader to Agg Stockpiles 431215 4439097.2 1489.9 0.00131 2.55 7.44 2.37 LD_AGS03 Loader to Agg Stockpiles 431223.9 4439098.7 1489.4 0.00131 2.55 7.44 2.37 LD_AGS04 Loader to Agg Stockpiles 431231.9 4439100 1488.9 0.00131 2.55 7.44 2.37 LD_AGS05 Loader to Agg Stockpiles 431232.6 4439099.5 1488.8 0.00131 2.55 7.44 2.37 LD_AGS06 Loader to Agg Stockpiles 431239.6 4439093.8 1488.4 0.00131 2.55 7.44 2.37 LD_AGS07 Loader to Agg Stockpiles 431246.6 4439088.2 1488.3 0.00131 2.55 7.44 2.37 LD_AGS08 Loader to Agg Stockpiles 431253.6 4439082.5 1488.3 0.00131 2.55 7.44 2.37 LD_AGS09 Loader to Agg Stockpiles 431260.6 4439076.9 1488.2 0.00131 2.55 7.44 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants A-13 ID Description X Coordinate (m) Y Coordinate (m) Elevation (m) Emission Rate (g/s) Release Height (m) Initial Lateral Dimension (m) Initial Vertical Dimension (m) LD_AGS10 Loader to Agg Stockpiles 431267.6 4439071.2 1488.1 0.00131 2.55 7.44 2.37 Kilgore Companies | PM10 and NO2 Modeling Analysis Trinity Consultants B-1 APPENDIX B. BLASTING SCREENING MODEL RESULTS Table B-1. below shows the results of the blasting location screening analysis described in Section 5.2/6.2. Gray highlighted rows indicate test location where blasting would produce maximum impacts. Table B-1. PM10 24-Hour and 1-Hr NO2 Location Screening Results Location UTM X (m) UTM Y (m) Elevation (m) 24-hr Averaging Period (PM10) 1-hr Averaging Period (NO2) Blasting 50 Blasting 50 1 431169.52 4438894.06 1524.57 548.2 645.3 2 431127.49 4438819.12 1523.33 465 750.8 3 430987.55 4438848.77 1557.82 1067.6 1906.2 4 430927.10 4438933.21 1556.24 805.1 1241.7 5 430893.68 4439051.27 1559.16 1052.5 1656.1 6 430903.63 4439127.70 1558.27 984.1 1474.1 7 431011.16 4439193.32 1518.13 1154.9 1661.4 8 431078.83 4439239.63 1505.58 869.5 1548.5 9 431047.03 4439358.71 1509.27 969.7 1811 10 431093.91 4439453.25 1500.81 844.3 1425.6 11 431019.08 4439470.43 1527.89 1087.4 1429.9 12 430948.54 4439411.57 1542.19 889.5 1451 13 430864.51 4439376.66 1576.72 853.3 1236.9 14 430782.30 4439356.78 1632.67 904.2 1598.3 15 430784.64 4439460.87 1624.42 772.5 1319.1 16 430786.26 4439530.34 1593.26 717.5 1174.1 17 430786.97 4439610.72 1578.12 1017.6 1822.8 18 430858.74 4439583.00 1551.12 727.2 1417 19 430988.70 4439596.86 1526.70 712.4 1047.2 20 431126.23 4439665.53 1486.88 454.1 990.6 Worst-case location: 7 3 87$+',9,6,212)$,548$/,7<± 127,&(2),17(17 .LOJRUH&RPSDQLHV!%HQMDPLQ+RW0L[$VSKDOWDQG $JJUHJDWH)DFLOLW\ 7R0RGLI\$SSURYDO2UGHU '$4($1 3UHSDUHG%\ %ULDQ0HQVLQJHU0DQDJLQJ&RQVXOWDQW &KDVH3HWHUVRQ&RQVXOWDQW 75,1,7<&2168/7$176 :DVDWFK%RXOHYDUG 6XLWH 6DOW/DNH&LW\8WDK 6XEPLWWHGRQEHKDOIRI .,/*25(&203$1,(6 :HVW6RXWK 6DOW/DNH&LW\87 )HEUXDU\ 3URMHFW .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQWLL 7$%/(2)&217(176 (;(&87,9(6800$5< *(1(5$/,1)250$7,21 2.1'HVFULSWLRQRI.LOJRUH¶V%HQMDPLQ3LW 2.2)HHV 2.3)RUPV '(6&5,37,212)352-(&7$1'352&(66 3.1'HVFULSWLRQRI.LOJRUH¶V3URMHFW 3.2'HVFULSWLRQRI.LOJRUH¶V3URFHVV 3.36LWH3ODQ (0,66,2165(/$7(',1)250$7,21 4.1&UXVKLQJDQG6FUHHQLQJ 4.20DWHULDO/RDGLQJ8QORDGLQJDQG7UDQVIHU 4.36LOR/RDGLQJ 4.46WRFNSLOHV 4.55RDGV 4.6%ODVWLQJ 4.7'ULOOLQJ 4.8+RW2LO+HDWHU 4.9$VSKDOW'UXP 4.10$VSKDOW6LOR/RDGLQJDQG/RDGRXW 4.117DQNV 4.126RXUFH6L]H'HWHUPLQDWLRQ %(67$9$,/$%/(&21752/7(&+12/2*<%$&7$1$/<6,6 5.1&UXVKLQJDQG6FUHHQLQJ$JJUHJDWH2SHUDWLRQV 5.25RDG(PLVVLRQV 5.3'ULOOLQJDQG%ODVWLQJ 5.4+0$3ODQW 5.5)XHO2LO6WRUDJH7DQNV 5.6$VSKDOW2LO6WRUDJH7DQNV 5.7'LVWXUEHG*URXQGV (0,66,21,03$&7$1$/<6,6 6.1&RPSDULVRQWR0RGHOLQJ7KUHVKROGV 121$77$,10(170$,17(1$1&($5($62))6(77,1* 7.12IIVHW$SSOLFDELOLW\ $33/,&$%/(5(*8/$7,216 8.1*HQHUDO,QWURGXFWLRQ±8WDK5HJXODWLRQV 8.2)HGHUDO5HJXODWLRQV )2506$ (0,66,21&$/&8/$7,216 % (&2120,&)($6,%,/,7<$1$/<6,6 & .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW (;(&87,9(6800$5< .LOJRUH&RPSDQLHV.LOJRUHLVDIXOOVFDOHFRQVWUXFWLRQPDWHULDOVFRPSDQ\WKDWRIIHUVSDYLQJDQG FRQVWUXFWLRQVHUYLFHVDVZHOODVUHDG\PL[FRQFUHWHKRWPL[DVSKDOW+0$DQGDJJUHJDWHV.LOJRUHLV SURSRVLQJWRLQFUHDVHWKHSURGXFWLRQVDOHDQGGLVWULEXWLRQRISURFHVVHGDJJUHJDWHDQG+0$DWLWVIDFLOLW\LQ %HQMDPLQ8WDKWKH%HQMDPLQ3LW7KH%HQMDPLQ3LWLVORFDWHGZLWKLQDQDUHDRI8WDK&RXQW\GHVLJQDWHGDV DQRQDWWDLQPHQWDUHDRIWKH1DWLRQDO$PELHQW$LU4XDOLW\6WDQGDUGV1$$46IRUSDUWLFXODWHPDWWHU30 ZLWKDQDHURG\QDPLFGLDPHWHURIPLFURQVRUOHVV30DQGKRXUR]RQH2[LGHVRIQLWURJHQ 12;VXOIXUGLR[LGH62YRODWLOHRUJDQLFFRPSRXQGV92&VDQGDPPRQLD1+DUHFRQVLGHUHG SUHFXUVRUVWR30LQ8WDK .LOJRUHFXUUHQWO\RSHUDWHVDJJUHJDWHPLQLQJDQG+0$SURGXFWLRQDFWLYLWLHVXQGHUDSSURYDORUGHU$2 '$4($1.LOJRUHLVVXEPLWWLQJD1RWLFHRI,QWHQW12,DLUSHUPLWDSSOLFDWLRQWRWKH8WDK 'LYLVLRQRI$LU4XDOLW\8'$4WRPRGLI\WKH%HQMDPLQ3LW¶VFXUUHQW$2E\LQFUHDVLQJWKHWKURXJKSXWVRIERWK DJJUHJDWHDQG+0$SURGXFW7KLV12,DLUSHUPLWDSSOLFDWLRQLVIRUDOODFWLYLWLHVDQGHPLVVLRQVUHODWHGWRWKH SURGXFWLRQVDOHDQGGLVWULEXWLRQRIDJJUHJDWHDQG+0$DWWKH%HQMDPLQ3LW (PLVVLRQVIURPWKLVSURMHFWZLOOFRQVLVWRI30ZLWKDQDHURG\QDPLFGLDPHWHURIPLFURQVRUOHVV30 3012;FDUERQPRQR[LGH&26292&VFDUERQGLR[LGHHTXLYDOHQW&2HDQGKD]DUGRXVDLU SROOXWDQWV+$3V7KH%HQMDPLQ3LWLVSURSRVHGWRFRQWLQXHWREHSHUPLWWHGDVDPLQRUVRXUFHDQGZLOOEH VXEMHFWWR&)51HZ6RXUFH3HUIRUPDQFH6WDQGDUGV16366XESDUW,DQG16366XESDUW222 (PLVVLRQFDOFXODWLRQVZHUHSHUIRUPHGIRUWKH%HQMDPLQ3LWWRGHWHUPLQHWKHSRWHQWLDOHPLVVLRQVRIFULWHULD SROOXWDQWVDVVRFLDWHGZLWKWKLVSURMHFW¶VLQFUHDVHVHH$SSHQGL[%7KHSURSRVHGHPLVVLRQVFRQVWLWXWHWKH %HQMDPLQ3LW¶VSRWHQWLDOWRHPLW37(VHH7DEOH6LWHZLGH37(YDOXHVIRUFULWHULDSROOXWDQWVJLYHQLQ WRQVSHU\HDUWS\DUHSURSRVHGDVIROORZV30 30 12; &2 62 92& DQG+$3V 7KLV12,DLUSHUPLWDSSOLFDWLRQKDVEHHQGHYHORSHGSXUVXDQW8WDK$GPLQLVWUDWLYH&RGH8$&5 DQG8WDK¶VDSSOLFDWLRQJXLGDQFHDQGLQFOXGHVEXWLVQRWOLPLWHGWR Ź12,)RUPVDQG)HHV Ź3URFHVV'HVFULSWLRQ Ź6LWH3ODQ Ź3RWHQWLDO(PLVVLRQ&DOFXODWLRQV Ź%HVW$YDLODEOH&RQWURO7HFKQRORJ\%$&7$QDO\VLV Ź$SSOLFDEOH5HJXODWRU\5HTXLUHPHQWVDQG Ź(PLVVLRQ,PSDFW$QDO\VLV .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW *(1(5$/,1)250$7,21 2.1'HVFULSWLRQRI.LOJRUH¶V%HQMDPLQ3LW .LOJRUH¶V%HQMDPLQ3LWRSHUDWHVDVERWKDQDJJUHJDWHSLWDQGDQ+0$SURGXFWLRQDQGVDOHVIDFLOLW\,WLV ORFDWHGDW6:%HQMDPLQ8WDK6WDQGDUGDJJUHJDWHDQG+0$HTXLSPHQWVXFKDVFUXVKHUV VFUHHQVVWRFNSLOHVKRSSHUVFRQYH\RUVVLORVDQGVWRUDJHWDQNVDUHSUHVHQWRQVLWH*HQHUDOSRZHULV SURYLGHGE\OLQHDQGWKHKRWPL[GUXPLVSRZHUHGE\WKHFRPEXVWLRQRIUHF\FOHGIXHORLO5)2RUZDVWH RLO7UXFNWUDIILFEULQJLQJUDZPDWHULDOVRQVLWHDQGKDXOLQJDJJUHJDWHDQG+0$SURGXFWRIIVLWHFRQWULEXWHV WRIXJLWLYHGXVWHPLVVLRQV )RU.LOJRUHWRSURGXFHSURFHVVHGDJJUHJDWHHDUWKZLWKLQWKHPLQHSRUWLRQRIWKH%HQMDPLQ3LWLVGULOOHG EODVWHGEXOOGR]HGDQGPDQLSXODWHGVRWKDWLWFDQEHORDGHGLQWRDFUXVKLQJDQGVFUHHQLQJRSHUDWLRQWKDW VL]HVLWSHUFXVWRPHUQHHGV$JJUHJDWHWKDWKDVEHHQFUXVKHGDQGVFUHHQHGLVFRQYH\HGWRVWDFNHUVDQG VWRFNSLOHGDFFRUGLQJWRVL]H,WLVWKHQORDGHGLQWRKDXOWUXFNVE\IURQWHQGORDGHUVIRUVDOHDQGGLVWULEXWLRQ IURPWKHVLWH )RU.LOJRUHWRSURGXFH+0$PDWHULDOVVXFKDVVDQGFRDUVHDJJUHJDWHOLPHDVSKDOWRLODQGUHF\FOHG DVSKDOWSURGXFW5$3DUHEURXJKWRQVLWHDQGVWRUHG6DQGFRDUVHDJJUHJDWHDQG5$3DUHVWRFNSLOHG OLPHLVSQHXPDWLFDOO\ORDGHGLQWRVLORVDQGDVSKDOWRLOLVXQORDGHGLQWRVWRUDJHWDQNV6WRFNSLOHGPDWHULDOLV ORDGHGLQWRKRSSHUVFRQYH\HGWKURXJKRXWWKHSURFHVVVFUHHQHGIRUVL]HGULHGDQGPL[HGZLWKOLPHDQG DVSKDOWRLOLQDKHDWHGPL[HUWRFUHDWH+0$7KHSURGXFW+0$LVWKHQVWRUHGLQVLORVDQGXQORDGHGLQWR WUXFNVIRUVDOHDQGGLVWULEXWLRQIURPWKHVLWH .LOJRUH¶V%HQMDPLQ3LWZLOOFRQWLQXHWREHSHUPLWWHGDVDPLQRUVRXUFHVHH7DEOH7KH6WDQGDUG ,QGXVWULDO&ODVVLILFDWLRQ6,&FRGHIRUWKH%HQMDPLQ3LWLV&RQVWUXFWLRQ6DQG *UDYHO7KH%HQMDPLQ 3LW¶VRSHUDWLRQVDUHFXUUHQWO\XQGHUZD\DWWKHVLWHXQGHU$2'$4($1.LOJRUHLVVHHNLQJWR LQFUHDVHLWVWKURXJKSXWRIERWKSURFHVVHGDJJUHJDWHDQG+0$,IWKHRSHUDWLQJVFHQDULRZHUHWR FKDQJHLQWKHIXWXUHRULIWKHWKURXJKSXWVZHUHWRUHTXLUHDQRWKHULQFUHDVH.LOJRUHZRXOGQRWLI\WKH 8'$4GD\VSULRUWRWKHFKDQJHRUVXEPLWDUHYLVHG12,DLUSHUPLWDSSOLFDWLRQ 7KH8QLYHUVDO7UDQVYHUVH0HUFDWRU870FRRUGLQDWHVIRU.LOJRUH¶V%HQMDPLQ3LWDUHDVIROORZV Ź(DVWLQJP Ź1RUWKLQJP Ź=RQH7 Ź870'DWXP1$' $OOFRUUHVSRQGHQFHUHJDUGLQJWKLVVXEPLVVLRQVKRXOGEHDGGUHVVHGWR 0U/HH:DUH :HVW6RXWK 6DOW/DNH&LW\87 OHHZDUH#NLOJRUHFRPSDQLHVFRP 3KRQH .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 2.2)HHV .LOJRUHZLOOXVH8'$4¶V3D\PHQW3RUWDOWRSUHSD\WKHIROORZLQJ8'$412,DLUSHUPLWDSSOLFDWLRQIHHV DVVRFLDWHGZLWKWKLVVXEPLWWDO Ź³$SSOLFDWLRQ)LOLQJ)HH´IRUWKH³1HZ0LQRU6RXUFHDQG0DMRUQRW36'6RXUFH´VRXUFHW\SH Ź³$SSOLFDWLRQ5HYLHZ)HH´IRUWKH³1HZ0LQRU6RXUFH´VRXUFHW\SH Ź7RWDO8'$4IHHV .LOJRUHXQGHUVWDQGVWKDWWKHWRWDOSHUPLWUHYLHZIHHLVEDVHGRQWKHWRWDODFWXDOWLPHVSHQWE\8'$4VWDII SURFHVVLQJWKLV12,DLUSHUPLWDSSOLFDWLRQ8SRQLVVXDQFHRIWKH$2LIWKHWRWDOUHYLHZWLPHLVPRUHWKDQ VWDQGDUGKRXUV8'$4ZLOOLQYRLFH.LOJRUHDWSHUKRXUIRUWKHDGGLWLRQDOWLPHDERYHVWDQGDUGKRXUV 2.3)RUPV 7KHIROORZLQJ8'$4IRUPVKDYHEHHQLQFOXGHGLQ$SSHQGL[$RIWKLVDSSOLFDWLRQ Ź)RUP1RWLFHRI,QWHQW12,$SSOLFDWLRQ&KHFNOLVW Ź)RUP&RPSDQ\,QIRUPDWLRQ1RWLFHRI,QWHQW Ź)RUP3URMHFW,QIRUPDWLRQ Ź)RUP(PLVVLRQV,QIRUPDWLRQ Ź)RUP)DEULF)LOWHUV%DJKRXVHV Ź)RUP5RFN&UXVKLQJDQG6FUHHQLQJ Ź)RUP1DWXUDO*DV%RLOHUVDQG/LTXLG+HDWHUV Ź)RUP2UJDQLF/LTXLG6WRUDJH7DQNV .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW '(6&5,37,212)352-(&7$1'352&(66 3.1'HVFULSWLRQRI.LOJRUH¶V3URMHFW .LOJRUHLVSURSRVLQJWRLQFUHDVHLWVGLVWXUEHGJURXQGVDQGVWRFNSLOHDUHDVLWVSURGXFWLRQRISURFHVVHG DJJUHJDWHIURPLWV&UXVKLQJDQG6FUHHQLQJFLUFXLWDQGLWVSURGXFWLRQRI+0$IURPLWV+0$3ODQW3URFHVVHG DJJUHJDWHZLOOLQFUHDVHE\WS\IRUDWRWDORIWS\+0$SURGXFWLRQZLOOEHLQFUHDVHGE\ WS\IRUDWRWDORIWS\7KHVHLQFUHDVHVZLOORFFXUDW.LOJRUH¶V%HQMDPLQ3LWLQ%HQMDPLQ 8WDK8WDK&RXQW\2QHWRQIO\DVKVLORLVWKHRQO\SLHFHRIHTXLSPHQWSURSRVHGWREHDGGHGWRWKH %HQMDPLQ3LW¶VHTXLSPHQWOLVWDWWKLVWLPH$OOHPLVVLRQVRXUFHVDUHVKRZQEHORZ6LWHZLGHHPLVVLRQ SURMHFWLRQVEDVHGRQWKLVHTXLSPHQWDUHGHWDLOHGLQ6HFWLRQ 3HUDLUGLVSHUVLRQPRGHOLQJDQDO\VHVFRQGXFWHGDQGVXEPLWWHGXQGHUDVHSDUDWHVXEPLWWDOWKHIROORZLQJ RSHUDWLQJUHVWULFWLRQVDUHWREHH[SHFWHG ჭ'ULOOLQJRSHUDWLRQVOLPLWHGIURPDPWRSPGDLO\ ჭ%ODVWLQJRSHUDWLRQVIURPDPWRSPGDLO\ ჭ1RPRUHWKDQVTXDUHIHHWRIVXUIDFHDUHDZLOOEHEODVWHGRQDQ\RQHGD\DQG ჭ7KH+0$3ODQWZLOOQRWEHRSHUDWLRQDOGXULQJWKHPRQWKVRI-DQXDU\DQG)HEUXDU\ &UXVKLQJDQG6FUHHQLQJ&LUFXLW Ź2QH-DZ&UXVKHU>WSK@ Ź2QH&RQH&UXVKHU>WSK@ Ź2QH9HUWLFDO6KDIW,PSDFW96,&UXVKHU>WSK@ Ź7KUHH¶[¶7ULSOHGHFN6FUHHQV>WSKHD@ Ź0LVFHOODQHRXV(TXLSPHQWIHHGHUVFRQYH\RUVVWDFNHUVZDVKVFUHZVZDVKVFUHHQVHWF Ź9DULRXV6WRFNSLOHV $VSKDOW3ODQW Ź2QH$VSKDOW0L['UXP>WSK@ Ź2QH¶[¶6FDOSLQJ6FUHHQZLWK5ROOHU>WSK@ Ź7KUHH$VSKDOW2LO6WRUDJH7DQNV>JDOHD@ Ź2QH/LPH6LOR>WRQV@ Ź2QH)O\$VK6LOR>WRQV@ Ź2QH5)26WRUDJH7DQN>JDO@ Ź7KUHH$VSKDOW6WRUDJH6LORV>WRQVHD@DQG Ź)LYH'LHVHO6WRUDJH7DQNV>JDOWRW@ 6XSSRUWLQJ2SHUDWLRQV Ź'ULOOLQJ Ź%ODVWLQJ Ź)URQWHQG/RDGHUV>2II+Z\(TXLSPHQW@DQG Ź'LVWXUEHG*URXQG 3.2'HVFULSWLRQRI.LOJRUH¶V3URFHVV .LOJRUH&UXVKLQJDQG6FUHHQLQJ&LUFXLW )LJXUHVKRZVDSURFHVVIORZGLDJUDP3)'RIWKH&UXVKLQJDQG6FUHHQLQJFLUFXLWSRUWLRQRIWKHDJJUHJDWH RSHUDWLRQV0DWHULDOLVEODVWHGIURPWKHPLQHDUHDZHWWHGDVQHFHVVDU\DQGWKHQWUDQVSRUWHGWRWKH SULPDU\IHHGHU$JJUHJDWHLVIHGIURPWKHIHHGHULQWRWKHMDZFUXVKHUIRULQLWLDOVL]LQJ&UXVKHGDJJUHJDWHLV .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW FRQYH\HGWRDFRQHFUXVKHUIRUIXUWKHUVL]LQJ3DUWRIWKHPDWHULDOIURPWKHRXWSXWRIWKHFRQHFUXVKHULV VWDFNHGLQWRDVWRFNSLOH7KHUHPDLQLQJPDWHULDOLVFRQYH\HGWRWKH96,FUXVKHULVVFUHHQHGE\XSWRWZR FRQVHFXWLYHWULSOHGHFNVFUHHQVDQGLVWKHQVWRFNSLOHGDFFRUGLQJWRWKHVL]HRIWKHSURFHVVHGDJJUHJDWH )LJXUH&UXVKLQJDQG6FUHHQLQJ&LUFXLW3URFHVV)ORZ'LDJUDP .LOJRUH+0$3ODQW )LJXUHVDQGVKRZWKH+0$3)'DQGZKHUHWKHSLHFHVRIHTXLSPHQWZLWKLQWKH3)'WDNHSODFHZLWKLQ WKH$VSKDOW3ODQW$JJUHJDWHDQG5$3DUHORDGHGLQWRELQVDQGFRQYH\HGWRWKHDJJUHJDWHGUXPGU\HUDQG GUXPPL[HU/LPHDQGIO\DVKDUHXQORDGHGIURPWKHLUVLORVLQWRWKHGUXPGU\HUDQGGUXPPL[HU/LTXLG DVSKDOWLVDGGHGWRWKHGUXPDQGPL[HGZLWKWKHDJJUHJDWH5$3OLPHDQGIO\DVKWRIRUP+0$SURGXFW 7KHGU\LQJDQGPL[LQJSURFHVVHVDUHFRQWUROOHGE\DEDJKRXVH+0$SURGXFWLVFRQYH\HGLQWRDVSKDOWVLORV ZKHUHLWLVWKHQORDGHGLQWRDVSKDOWWUXFNVWREHKDXOHGRIIVLWH .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW )LJXUH+0$3ODQW3URFHVV)ORZ'LDJUDP )LJXUH+0$3ODQW0DS .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 3.36LWH3ODQ )LJXUHVKRZQEHORZSURYLGHVDYLFLQLW\PDSRIWKH%HQMDPLQ3LWZKHUH.LOJRUHFXUUHQWO\RSHUDWHVVLWH ERXQGDULHVDUHJLYHQLQJUHHQ)LJXUHSURYLGHVDFORVHUYLHZRIWKHDJJUHJDWHDQG+0$IDFLOLWLHVZLWK WKHERXQGDULHVDOVRJLYHQLQJUHHQ )LJXUH6LWH9LFLQLW\ .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW )LJXUH$JJUHJDWHDQG$VSKDOW)DFLOLW\&ORVHXS .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW (0,66,2165(/$7(',1)250$7,21 7KLVVHFWLRQGHWDLOVWKHPHWKRGRORJ\XVHGWRFDOFXODWHGFRQWUROOHGDQGXQFRQWUROOHGHPLVVLRQVIRUFULWHULD SROOXWDQWVJUHHQKRXVHJDVHVDQGKD]DUGRXVDLUSROOXWDQWV+$3VDVVRFLDWHGZLWKHDFKQHZXQLWDQGLWV DVVRFLDWHGIXJLWLYHVDVUHJXODWHGE\5E$GGLWLRQDOO\DFRPSDULVRQWRPDMRUVRXUFH WKUHVKROGVLVFRQGXFWHG'HWDLOHGHPLVVLRQFDOFXODWLRQWDEOHVDUHLQFOXGHGLQ$SSHQGL[% 4.1&UXVKLQJDQG6FUHHQLQJ 3030DQG30HPLVVLRQVJHQHUDWHGIURPWKHFUXVKLQJDQGVFUHHQLQJRIDJJUHJDWHDVZHOODVWKH VFUHHQLQJRIDVSKDOWLQSXWPDWHULDODUHHVWLPDWHGE\PXOWLSO\LQJWKHPDWHULDOWKURXJKSXWE\WKHDSSURSULDWH HPLVVLRQIDFWRU()&RQWUROOHG()VIRUVFUHHQLQJDQGFUXVKLQJZHUHREWDLQHGIURPWKH(QYLURQPHQWDO 3URWHFWLRQ$JHQF\¶V(3$¶V3RWHQWLDOWR(PLW&DOFXODWRUIRU6WRQH4XDUU\LQJ&UXVKLQJDQG6FUHHQLQJ3ODQWV ODVWXSGDWHG1RYHPEHU7KHHTXDWLRQXVHGLVDVIROORZV ሺሻ ൌ ൬ ൰ ൈ ሺሻ ൈ൬ ʹǡͲͲͲ൰ ൈ 4.20DWHULDO/RDGLQJ8QORDGLQJDQG7UDQVIHU )RUFRQYH\RUWUDQVIHUSRLQWVFRQWUROOHG()VIURP(3$¶V3RWHQWLDOWR(PLW&DOFXODWRUIRU6WRQH4XDUU\LQJ &UXVKLQJDQG6FUHHQLQJ3ODQWV1RYHPEHUZHUHXVHG)RUGURSSHGPDWHULDOWUDQVIHULQFOXGLQJ VWDFNHUGURSVUHVXOWLQJIURPWKHFUXVKLQJDQGVFUHHQLQJRSHUDWLRQVPDWHULDOORDGLQJLQERWKDJJUHJDWHDQG DVSKDOWIDFLOLWLHVDQGPDWHULDOXQORDGLQJLQWKHDJJUHJDWHIDFLOLW\WKHXQFRQWUROOHG30DQG30()VZHUH REWDLQHGIURPWKH³GURSHTXDWLRQ´LQ$36HFWLRQ1RYHPEHU7KHHTXDWLRQIRUDOOHPLWWLQJ GURSVLV ൌ ሺͲǤͲͲ͵ʹሻ ൈ ቀ ͷ ቁ ଵǤଷ ቀ ʹ ቁ ଵǤସ ZKHUH ( HPLVVLRQIDFWRUVOEWRQ N SDUWLFOHVL]HPXOWLSOLHUGLPHQVLRQOHVV 8 PHDQZLQGVSHHGPSK 0 PDWHULDOPRLVWXUHFRQWHQW 3DUDPHWHU³8´LVGHWHUPLQHGIURPWKHYDOXHJLYHQIRU8WDK&RXQW\LQ8'$4¶V$YHUDJH$QQXDO:LQG6SHHG PDS1RYHPEHU7KHPDWHULDOPRLVWXUHFRQWHQWXVHGLQWKLVHTXDWLRQIRUFUXVKLQJDQGVFUHHQLQJ RSHUDWLRQVLVEDVHGRQYDOXHVSUHYLRXVO\UHFRPPHQGHGE\8'$4 7KHDQQXDO30HPLVVLRQVUDWHIRUERWKWKHDJJUHJDWHDQGDVSKDOWSRUWLRQVRIWKHIDFLOLW\JLYHQLQWS\LV VKRZQE\WKHHTXDWLRQEHORZ7KH()FRUUHVSRQGVWRWKHDQQXDOHPLVVLRQVRIWKHFULWHULDSROOXWDQWLQ TXHVWLRQDWWKHWLPHRIXVHRIWKHHTXDWLRQQDPHO\30RU30 .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW ሺሻ ൌ ሺሻ ൈ ൬ ൰ ൈ ൈ ൬ ͳ ʹǡͲͲͲ൰ 4.36LOR/RDGLQJ 6LORORDGLQJRSHUDWLRQV±WUDQVSRUWLQJIO\DVKDQGOLPHIURPGHOLYHU\WUXFNVWRWKHLUUHVSHFWLYHVLORV±DUH FRQGXFWHGYLDSQHXPDWLFWUDQVIHU7KLVSURFHVVJHQHUDWHV3030DQG+$3VHPLVVLRQVDVSROOXWDQW ODGHQDLULQVLGHWKHVLORVLVGLVSODFHGGXULQJWKHORDGLQJSURFHVVSHU$36HFWLRQ&RQFUHWH%DWFKLQJ 7KHUHHPLVVLRQIDFWRUVDUHJLYHQIRUHDFKSROOXWDQWEDVHGRQWKHWKURXJKSXWRIPDWHULDOORDGHG30DQG 30HPLVVLRQUDWHVDUHJLYHQLQXQLWVRIWS\SRXQGSHUKRXUOEKUDQGJUDPVSHUVHFRQGJVHF+$3 HPLVVLRQVDUHJLYHQLQWS\DQGOEKU)RUHPLVVLRQFDOFXODWLRQSXUSRVHVLWKDVEHHQFRQVHUYDWLYHO\DVVXPHG WKDWWKHSROOXWDQWSURILOHIRUSQHXPDWLFVLORORDGLQJRIOLPHLVHTXLYDOHQWWRWKDWRIFHPHQW7KHHTXDWLRQV DUHGHVFULEHGEHORZ ሺሻ ൌ ൬ ൰ ൈ ሺሻ ൈ ൬ ͳ ʹǡͲͲͲ൰ ൬ ൰ൌ ൬ ൰ ൈ ൬ ൰ ቀ ቁ ൌ ൬ ൰ ൈ ൬ Ͷͷ͵Ǥͷͻ ൰ ൈ ൬ ͳ ͵ǡ͸ͲͲ൰ 4.46WRFNSLOHV $PD[LPXPWRWDOVWRFNSLOHDUHDZDVGHWHUPLQHGEDVHGRQDFRQVHUYDWLYHHQJLQHHULQJHVWLPDWHRIWKH IDFLOLW\,WLVDVVXPHGWKDWWKHWRWDOVWRFNSLOHDUHDZLOOQRWH[FHHGWKHUHSRUWHGVL]HRQDQ\JLYHQGD\7KH PD[LPXPSLOHDUHDLVPXOWLSOLHGE\DQ()DORQJZLWKVHYHUDOFRQYHUVLRQIDFWRUVWRGHWHUPLQHWKHSRWHQWLDO HPLVVLRQVDVVRFLDWHGZLWKHDFKVWRFNSLOH()VDUHFKRVHQEDVHGRQZKDWVL]HWKHSDUWLFOHLV30RU30 DQGZKHWKHUWKHVWRFNSLOHLVFRQWUROOHGRUXQFRQWUROOHG$OOVWRFNSLOHVZLOOEHFRQWUROOHGZLWKZDWHU DSSOLFDWLRQ8QFRQWUROOHG()VDQGFRQWUROHIILFLHQFLHVIRUZDWHULQJZHUHREWDLQHGIURP$3)RXUWK(GLWLRQ 7DEOHDQG$3$SSHQGL[%7DEOH% ሺሻ ൌ Ǥ ሺሻ ൈ ൬ ڄ ൰ ൈ ൬ ͵͸ͷ ൈ ͳ ͳ ൈ ʹǡͲͲͲ ൰ 8'$4DQG.LOJRUHKDYHHQJDJHGLQGLVFXVVLRQVUHJDUGLQJWKHFRQWUROPHWKRGXVHGRQVWRFNSLOHVDWWKH %HQMDPLQ3LW.LOJRUHKDVXVHGWKHFRQVHUYDWLYHFRQWUROHIILFLHQFLHVJLYHQE\8'$4IRUWKHDSSOLFDWLRQRI ZDWHUWRVWRFNSLOHVIRU30DQGIRU30UDWKHUWKDQWKHPXFKPRUHPRGHUDWHFRQWURO HIILFLHQF\UDQJHJLYHQE\LQWKH:HVWHUQ5HJLRQDO$LU3DUWQHUVKLS¶V:5$3¶V)XJLWLYH'XVW+DQGERRN 8VLQJ8'$4¶VUHTXHVWHGFRQWUROHIILFLHQFLHVUDWKHUWKDQWKHPRUHFRQVHUYDWLYHYDOXHVRI:5$3LV SURSRVHGDVDQDFFHSWDEOHUHSUHVHQWDWLRQRIWKHFRQWUROUHDOL]HGE\.LOJRUH¶VZDWHULQJRIVWRFNSLOHVDWLWV %HQMDPLQ3LW $3)RXUWK(GLWLRQ7DEOH $3$SSHQGL[%7DEOH% ,ELG :HVWHUQ5HJLRQDO$LU3DUWQHUVKLS)XJLWLYH'XVW+DQGERRN([HFXWLYH6XPPDU\6HSWHPEHU .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 4.55RDGV 7KHKDXOURDGVDW.LOJRUH¶V%HQMDPLQ3LWFRQVLVWRIERWKXQSDYHGDQGSDYHGURDGV30DQG30HPLVVLRQV ZHUHGHULYHGXVLQJWKHJXLGDQFHIRXQGLQ8'$4¶V0DUFKPHPRUDQGXPUHJDUGLQJ()VIRUXQSDYHG KDXOURDGVZLWKWKHDSSOLFDEOHFRQWUROIDFWRUVDSSOLHG(PLVVLRQVIURPWKHVHURDGVZHUHFDOFXODWHGXVLQJ WKHIROORZLQJHTXDWLRQ ൌ ൈ ቀ ͳʹቁ ୟ ൈ൬ ͵ ൰ ୠ ൈൈ ͳ ʹǡͲͲͲൈሺͳെɄሻ :KHUH 30 303030HPLVVLRQVWS\ N 303030N)DFWRUOE907 V $YHUDJHVLOWFRQWHQW : 0HDQYHKLFOHZHLJKWWRQV ' 'LVWDQFHWUDYHOHG907\U D &RQVWDQWIRUHTXDWLRQYDULHVIRU303030XQLWOHVV E &RQVWDQWIRUHTXDWLRQYDULHVIRU303030XQLWOHVV ǆ &RQWUROHIILFLHQF\ 3DUDPHWHU:LVGHWHUPLQHGIRUHDFKYHKLFOHW\SHE\WDNLQJWKHDYHUDJHRIWKHPHDQORDGHGDQGXQORDGHG ZHLJKWVRIWKHGLIIHUHQWW\SHVRIYHKLFOHVLQWKLVFDVHWUDFWRUWUDLOHUVDQGIURQWHQGORDGHUV3DUDPHWHU 'LVGHWHUPLQHGE\XVLQJWKHSURGXFWWKURXJKSXWGLYLGHGE\WKHGLIIHUHQFHLQIXOODQGHPSW\YHKLFOHZHLJKW WRGHWHUPLQHWKHWRWDOQXPEHURIKDXOVUHTXLUHG7KLVYDOXHLVPXOWLSOLHGE\WKHURXQGWULSGLVWDQFHWUDYHOHG E\WKHFXVWRPHUWUXFNV7KHDYHUDJHVLOWFRQWHQWXVHGLQWKLVHTXDWLRQLVJLYHQSHU8'$4¶VJXLGDQFHRQ SDYHGDQGXQSDYHGKDXOURDGV $VDPHDQVRIFRQWURODZDWHULQJWUXFNUHJXODUO\DSSOLHVZDWHUWRVXSSUHVVIXJLWLYH30HPLVVLRQVDW .LOJRUH¶V%HQMDPLQ3LWIRUORDGHUWUDYHO7KHXQSDYHGSRUWLRQRIWKHPDLQKDXOURXWHKDVDURDGEDVHRI5$3 ,QDGGLWLRQFKHPLFDOVXSSUHVVDQWLQDGGLWLRQWRZDWHULQJLVDSSOLHGDVQHFHVVDU\WRWKHXQSDYHGSRUWLRQV RIWKHPDLQKDXOURXWH3DYHGSRUWLRQVRIWKHURDGDUHYDFXXPVZHSWDQGZDWHUHG7KHUHIRUHXVLQJ JXLGDQFHIURPWKHPHPRUDQGXPLVVXHGE\8'$4UHJDUGLQJHPLVVLRQIDFWRUVIRUSDYHGDQGXQSDYHGKDXO URDGVDFRQWUROIDFWRURIIRUEDVLFZDWHULQJRQURDGEDVHDQGDFRQWUROIDFWRURIFKHPLFDO VXSSUHVVDQWDSSOLFDWLRQDQGZDWHULQJZHUHXVHGIRUIXJLWLYHHPLVVLRQVUHODWHGWRYHKLFOHWUDIILFRQXQSDYHG URDGV$FRQWUROIDFWRURIIRUYDFXXPVZHHSLQJDQGZDWHUDSSOLFDWLRQZDVXVHGIRUIXJLWLYHHPLVVLRQV UHODWHGWRYHKLFXODUWUDIILFRQWKHSDYHGSRUWLRQVRIWKHPDLQKDXOURXWH/RDGHUWUDPOHQJWKVWRSURGXFW KDXOWUXFNVDUHFRQVHUYDWLYHO\HVWLPDWHGWREHIHHWSHUKDXODVWKHPDMRULW\RIORDGHURSHUDWLRQVVHUYH WRORDGHTXLSPHQWRUYHKLFOHVLQGLVWLQFWDUHDV/RDGHUWUDPOHQJWKVIRURWKHURSHUDWLRQVFDQEHIRXQGLQWKH HPLVVLRQVFDOFXODWLRQVSUHVHQWHGLQWKLVGRFXPHQW(PLVVLRQVZHUHSURMHFWHGEDVHGRQWKH%HQDMPLQ3LW¶V URDGOD\RXWVYHKLFOHZHLJKWVDQGKDXOLQJFDSDFLW\ 4.6%ODVWLQJ )RU.LOJRUHWRSURGXFHSURFHVVHGDJJUHJDWHGULOOLQJDQGEODVWLQJRSHUDWLRQVZLOOEHFRQGXFWHGZLWKLQWKH PLQLQJDUHDWRSURGXFHDJJUHJDWHLQDPDQDJHDEOHVL]HZKLFKZLOOWKHQEHWUDQVSRUWHGYLDEXOOGR]HUIURQW 3HUPHPRUDQGXPLVVXHGE\8'$4³(PLVVLRQ)DFWRUVIRU3DYHGDQG8QSDYHG+DXO5RDGV´GDWHG-DQXDU\ 1DWLRQDO$FDGHP\RI6FLHQFHV7HFKQRORJLHVDQG$SSURDFKHVWR5HGXFLQJWKH)XHO&RQVXPSWLRQRI0HGLXPDQG+HDY\'XW\ 9HKLFOHVSUHSXEOLFDWLRQFRS\0DUFKSSDQG7DEOH 3HU8$&57DEOH 3HUPHPRUDQGXPLVVXHGE\8'$4³(PLVVLRQ)DFWRUVIRU3DYHGDQG8QSDYHG+DXO5RDGV´GDWHG-DQXDU\ .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW HQGORDGHUVWRWKHFUXVKLQJDQGVFUHHQLQJRSHUDWLRQV7KHPD[LPXPEODVWLQJDUHDLVVTXDUHIHHW IWRQDUROOLQJPRQWKSHULRGDQGZDVSURYLGHGSHUGHVLJQEDVLV 7KHEODVWLQJ62HPLVVLRQIDFWRULVREWDLQHGIURP$36HFWLRQ7KH62()ZDVGHYHORSHGXVLQJD PDVVEDODQFHWKDWDVVXPHVDIXHORLOPL[WXUHZLWKSSPVXOIXUFRQWHQWFRQVLVWHQWZLWK(3$QRQ URDGVWDQGDUGV ୗ୓మ ൬ ൰ ൌ ሺሻ ൈ Ψ୊୳ୣ୪୓୧୪୑୧୶୲୳୰ୣ ൈ %RWKWKH12;DQG&2()LVWKDWRIWKH$1)2EODVWLQJDJHQWIDFWRUIURP$36HFWLRQDQG 30DQG30()VZHUHEDVHGRQWKHEODVWLQJ30()JLYHQLQ$3ZKHUHDPD[LPXPEODVWLQJ GHSWKRIIHHWLVXVHGE\WKHIROORZLQJHTXDWLRQ ୔୑ ൬ ൰ ൌ ͳǤͶ ൈ ͳͲ ିହ ൈሺଶ ሻଵǤହ :KHUH()30LVWKH()RI30LQSRXQGVSHUEODVWDQG$LVWKHDYHUDJHGDLO\EODVWDUHDLQVTXDUHIHHW 6FDOLQJIDFWRUVZHUHDSSOLHGWRWKH763()WRFDOFXODWH30DQG30()VUHVSHFWLYHO\SHU$37DEOH DVVHHQEHORZ,WLVFRQVHUYDWLYHO\DVVXPHGWKDWWKH30()LVHTXDOWRWKH763() ୔୑భబ ൬ ൰ൌ ୔୑ ൬ ൰ ൈ ͲǤͷʹ ୔୑మǤఱ ൬ ൰ൌ ୔୑ ൬ ൰ ൈ ͲǤͲ͵ :KHUH()30LVWKH()RI30JLYHQLQSRXQGVSHUEODVWDQG()30LVWKH()RI30JLYHQLQSRXQGVSHU EODVW,WLVDVVXPHGWKDWSRXQGVSHUEODVWLVHTXLYDOHQWWRSRXQGVSHUGD\ 'DLO\IXJLWLYHGXVW3030DQG30EODVWLQJHPLVVLRQVZHUHFDOFXODWHGXVLQJEODVWLQJPDWHULDO TXDQWLWLHVZKLFKZHUHSURYLGHGSHUGHVLJQEDVLV%ODVWLQJHPLVVLRQVDUHFDOFXODWHGDVIROORZV ൬ ൰ൌ ൬ ൰ൈሺͳെΨୡ୭୬୲୰୭୪ሻ ൈ൬ͳ ൰ ZKHUHWKH()LVWKDWRI3030RU30ZKLFKHYHULVFDOFXODWHG $QQXDOIXJLWLYHGXVW3030DQG30EODVWLQJHPLVVLRQVDUHJLYHQDVIROORZV ሺሻ ൌ ൬ ൰ ൈ ͓ ൈ ൬ ڄ ڄ ൰ :KHUHWKH'DLO\)XJLWLYH'XVW(PLVVLRQVDUHWKRVHRI3030RU30ZKLFKHYHULVFDOFXODWHG 'DLO\HPLVVLRQVIRU6212;DQG&2DUHFDOFXODWHGIRUHDFKSROOXWDQWDVIROORZV ൬ ൰ൌ ൬ ൰ ൈ ሺሻ ൈ ൬ ൰ .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW $QQXDOHPLVVLRQVIRU6212;DQG&2DUHFDOFXODWHGIRUHDFKSROOXWDQWDVIROORZV ሺሻ ൌ ൬ ൰ ൈ ሺሻ ൈ ൬ ൰ 4.7'ULOOLQJ 'ULOOLQJRSHUDWLRQVSUHFHGHEODVWLQJRSHUDWLRQVDOORZLQJIRUWKHSODFHPHQWRIH[SORVLYHVEHQHDWKWKHVXUIDFH RIWKHPLQH¶VVXUIDFH)RUGULOOLQJHPLVVLRQVWKHIROORZLQJDVVXPSWLRQVDUHDSSOLHG 7KHGULOOLQJ30()LVUHWULHYHGIURP$36HFWLRQXWLOL]LQJWKHFRQVHUYDWLYHGULOOLQJ30()JLYHQIRU RYHUEXUGHQPDWHULDO$VQR()VDUHSURYLGHGIRU30DQG30GULOOLQJRSHUDWLRQV()VZHUHFDOFXODWHG XVLQJWKH30DQG30WR763UDWLRVIRUEODVWLQJRYHUEXUGHQSHU$36HFWLRQZKHUHWKHIDFWRUIRU 30LVDQGWKHIDFWRUIRU30LVDVVKRZQEHORZ ୔୑భబ ൌ ୔୑భఱ ൈͲǤͷʹ $QG ୔୑మǤఱ ൌ ୘ୗ୔ ൈͲǤͲ͵ )RUWKHSXUSRVHVRIGHWHUPLQLQJWKH30DQG30()VWKH()IRU3030DQG763DUHFRQVLGHUHG HTXLYDOHQW 7KHGDLO\HPLVVLRQVRI3030DQG30ZHUHFDOFXODWHGDVIROORZV ൬ ൰ൌ ൬ ൰ ൈ ͓൬ ൰ൈሺͳെΨୡ୭୬୲୰୭୪ ሻ :KHUHERWKWKHGDLO\HPLVVLRQVDQGWKH()DUHWKRVHRIWKHSROOXWDQWLQTXHVWLRQLH3030RU30 7KHDQQXDOHPLVVLRQVRI3030DQG30ZHUHFDOFXODWHGDVIROORZV ሺሻ ൌ ൬ ൰ ൈ ൬ ൰ൈሺͳെΨୡ୭୬୲୰୭୪ ሻ ൈ ൬ ൰ :KHUHERWKWKHDQQXDOHPLVVLRQVDQGWKH()DUHWKRVHRIWKHSROOXWDQWLQTXHVWLRQLH3030RU30 4.8+RW2LO+HDWHU 7KHSURSRVHGWKUHHJDOORQOLTXLGDVSKDOWWDQNVZLOOEHKHDWHGZLWKD00%WXKRWRLOKHDWHU WKDWZLOOEHILUHGE\5)2(PLVVLRQVDUHHVWLPDWHGIURPWKLVKHDWHUEDVHGRQWKHHPLVVLRQIDFWRUVIRUFULWHULD SROOXWDQWVLQ1R)XHO2LOIURP$36HFWLRQ)XHO2LO&RPEXVWLRQ(PLVVLRQVIURPWKHKRWRLOKHDWHU ZHUHFDOFXODWHGXVLQJWKHIROORZLQJHTXDWLRQ ሺሻ ൌ ൬ ͳͲଷ ൰ ൈ ൬ ൰ ൈ ൬ ͳ ʹǡͲͲͲ൰ൈ൬ ͳ ͳǡͲͲͲ൰ 4.9$VSKDOW'UXP (PLVVLRQVIRUWKHDVSKDOWGUXPGU\HUZLOOEHFRQWUROOHGE\WKHXVHRIDSULPDU\FROOHFWRUDQGEDJKRXVH7KH DVSKDOWGUXPGU\HULVEHLQJXSGDWHGDVSDUWRIWKLVSURMHFWWRXVHDORZ12;EXUQHU/1%(PLVVLRQIDFWRUV .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW IRU3012;&262DQG92&VKDYHEHHQWDNHQIURP$3+RW0L[$VSKDOW3ODQWVDQGDUHWKRVH WKDWFRUUHODWHZLWKWKHXVHRIDIDEULFILOWHUEDJKRXVH(PLVVLRQIDFWRUVSURYLGHGDUHLQXQLWVRIOEWRQRI +0$SURGXFHG(PLVVLRQVIURPWKHGU\HUEDJKRXVHZHUHFDOFXODWHGXVLQJWKHIROORZLQJHTXDWLRQ ሺሻ ൌ ൬ ൰ ൈ ൬ ൰ൈ൬ ʹǡͲͲͲ൰ 7KHDVSKDOWGUXPGU\HUZLOOEHIXHOHGE\5)2DQGKDYHDQLQFUHDVHLQDQQXDOWKURXJKSXWRIWRQVRI +0$SHU\HDUIRUWKHSXUSRVHVRIWKLVSURMHFW 4.10$VSKDOW6LOR/RDGLQJDQG/RDGRXW )XJLWLYH3030&2DQG92&HPLVVLRQVDUHJHQHUDWHGGXULQJWKHVLORILOOLQJDQGSODQWORDGRXWRI+0$ IURPWKHGUXPPL[HUWRWKHVWRUDJHVLORDQGIURPWKHORDGRXWRSHUDWLRQVWRWKHGHOLYHU\WUXFNV(PLVVLRQ IDFWRUVIRU+0$ORDGRXWDQGVLORILOOLQJRSHUDWLRQVDUHFDOFXODWHGEDVHGRQWKHPHWKRGRORJ\GHVFULEHGLQ 86(3$$36HFWLRQ+RW0L[$VSKDOW3ODQWV$VSKDOWVLORHPLVVLRQIDFWRUVDUHFDOFXODWHGDV IROORZV )RUVLORILOOLQJ ൬ ൰ ൌ ͲǤͲͲͲ͵͵ʹ ൅ ͲǤͲͲͳͲͷ ሺെሻሺሺ଴Ǥ଴ଶହଵሻሺ୘ାସ଺଴ሻିଶ଴Ǥସଷሻ ൬ ൰ ൌ ͲǤͲͷͲͶ ሺെሻሺሺ଴Ǥ଴ଶହଵሻሺ୘ାସ଺଴ሻିଶ଴Ǥସଷሻ ൬ ൰ ൌ ͲǤͲͲͶͺͺ ሺെሻሺሺ଴Ǥ଴ଶହଵሻሺ୘ାସ଺଴ሻିଶ଴Ǥସଷሻ )RUVLORORDGRXW ൬ ൰ ൌ ͲǤͲͲͲͳͺͳ ൅ ͲǤͲͲͳͶͳ ሺെሻሺሺ଴Ǥ଴ଶହଵሻሺ୘ାସ଺଴ሻିଶ଴Ǥସଷሻ ൬ ൰ ൌ ͲǤͲͳ͹ʹ ሺെሻሺሺ଴Ǥ଴ଶହଵሻሺ୘ାସ଺଴ሻିଶ଴Ǥସଷሻ ൈ ͻͶΨ ൬ ൰ ൌ ͲǤͲͲͷͷͺ ሺെሻሺሺ଴Ǥ଴ଶହଵሻሺ୘ାସ଺଴ሻିଶ଴Ǥସଷሻ ZKHUH 9 DVSKDOWYRODWLOLW\ 7 GHIDXOW+0$WHPSHUDWXUH)SHU)RRWQRWHDRI$36HFWLRQ7DEOH )RUVLORILOOLQJRI72&DUHHVWLPDWHGWREH92&VSHU$36HFWLRQ30DQG30HPLVVLRQ IDFWRUVDUHFRQVHUYDWLYHO\DVVXPHGWREHHTXDOWRWRWDO30HPLVVLRQIDFWRUV 3HU86(3$$37DEOH .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 4.117DQNV $QQXDO92&HPLVVLRQVIURPIL[HGURRIVWRUDJHWDQNVDUHFDOFXODWHGXVLQJWKHPHWKRGRORJ\SURYLGHGLQWKH )LIWK(GLWLRQRI$3&KDSWHU/LTXLG6WRUDJH7DQNVODVWXSGDWHGLQ0DUFKRIDOOHTXDWLRQV WDEOHVDQGILJXUHVUHIHUHQFHGKHUHUHIHUWR$36HFWLRQ 7KHSRWHQWLDO92&HPLVVLRQHVWLPDWHVDFFRXQWIRUWKHZRUNLQJDQGVWDQGLQJORVVHVDVVRFLDWHGZLWKFKDQJHV LQWHPSHUDWXUHSUHVVXUHDQGOLTXLGOHYHO/LTXLGWKURXJKSXWIRUDOOWDQNVLVHVWLPDWHGEDVHGRQWKHDQQXDO SURGXFWLRQLQFUHDVHRIWS\RI+0$SURGXFW 3HU(TXDWLRQWKHWRWDOURXWLQHORVVHVIRUPWKHIL[HGURRIWDQNVDUHHTXDOWRWKHVXPRIWKHVWDQGLQJORVV DQGZRUNLQJORVV ܮ் ൌܮௌ ൅ܮௐ :KHUH /7 WRWDOORVVHVOE\U /6 VWDQGLQJVWRUDJHORVVHVOE\U /: ZRUNLQJORVVHVOE\U 7KHVWDQGLQJVWRUDJHORVVDQGZRUNLQJORVVFRPSRQHQWVRIWKHWRWDOORVVHTXDWLRQDUHGLVFXVVHGLQWKH VXEVHFWLRQVEHORZ 6WDQGLQJ6WRUDJH/RVV $QQXDOIL[HGURRIVWDQGLQJORVVHVFDQEHHVWLPDWHGXVLQJ(TXDWLRQ ܮ௦ ൌ ͵͸ͷሺܸ௩ ሻሺܹ௏ ሻሺܭா ሻሺܭௌ ሻ :KHUH /6 VWDQGLQJVWRUDJHORVVOE\U 99 YDSRUVSDFHYROXPHIW :Y VWRFNYDSRUGHQVLW\OEIW .( YDSRUVSDFHH[SDQVLRQIDFWRUGLPHQVLRQOHVV .6 YHQWHGYDSRUVDWXUDWLRQIDFWRUGLPHQVLRQOHVV FRQVWDQWWKHQXPEHURIGDLO\HYHQWVLQD\HDUGD\V\U 7DQN9DSRU6SDFH9ROXPH99 7KHWDQNYDSRUVSDFHYROXPH99LVFDOFXODWHGXVLQJ(TXDWLRQ ܸ௏ ൌቀߨ Ͷ ܦ ଶ ቁܪ௏ை :KHUH 99 YDSRUVSDFHYROXPHIW ' LQWHUQDOWDQNGLDPHWHUIW +92 YDSRUVSDFHRXWDJHIW 7KHVWDQGLQJORVVHTXDWLRQFDQEHVLPSOLILHGE\FRPELQLQJ(TXDWLRQZLWK(TXDWLRQWRGHULYH (TXDWLRQ ܮ௦ ൌ ͵͸ͷܭா ቀߨ Ͷ ܦଶ ቁ ሺܪ௏ை ሻሺܭௌ ሻሺܹ௏ ሻ :KHUH .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW /6 VWDQGLQJVWRUDJHORVVOE\U .( YDSRUVSDFHH[SDQVLRQIDFWRUGLPHQVLRQOHVV ' LQWHUQDOWDQNGLDPHWHUIW +92 YDSRUVSDFHRXWDJHIW .6 YHQWHGYDSRUVDWXUDWLRQIDFWRUGLPHQVLRQOHVV :Y VWRFNYDSRUGHQVLW\OEIW FRQVWDQWWKHQXPEHURIGDLO\HYHQWVLQD\HDUGD\V\U 9DSRU6SDFH([SDQVLRQ)DFWRU.( 7KHFDOFXODWLRQRIWKHYDSRUVSDFHH[SDQVLRQIDFWRU.(GHSHQGVXSRQWKHSURSHUWLHVRIWKHOLTXLGLQWKH WDQNDQGWKHEUHDWKHUYHQWVHWWLQJVDQGLVUHSUHVHQWHGE\(TXDWLRQ ܭா ൌ οܶ௏ ܶ௅஺ ൅οܲ௏ െοܲ஻ ܲ஺ െܲ௏஺ :KHUH 79 DYHUDJHGDLO\YDSRUWHPSHUDWXUHUDQJH 25 ¨39 DYHUDJHGDLO\YDSRUSUHVVXUHUDQJHSVL ¨3% EUHDWKHUYHQWSUHVVXUHVHWWLQJUDQJHSVL 3$ DWPRVSKHULFSUHVVXUHSVLD 39$ YDSRUSUHVVXUHDWDYHUDJHGDLO\OLTXLGVXUIDFHWHPSHUDWXUHSVLD 7/$ DYHUDJHGDLO\OLTXLGVXUIDFHWHPSHUDWXUH25 )RUDQXQLQVXODWHGWDQNWKHDYHUDJHGDLO\YDSRUWHPSHUDWXUHUDQJHLVFDOFXODWHGXVLQJ(TXDWLRQ οܶ௏ ൌቌͳെ ͲǤͺ ʹǤʹቀܪ௦ܦ ቁ൅ͳǤͻ ቍοܶ஺ ൅ ͲǤͲͶʹ ןோ ܫ ൅ ͲǤͲʹ͸ቀ ܪௌܦ ቁןௌ ܫ ʹǤʹቀܪௌܦ ቁ൅ͳǤͻ :KHUH ¨79 DYHUDJHGDLO\YDSRUWHPSHUDWXUHUDQJH 25 +6 WDQNVKHOOKHLJKWIW ' LQWHUQDOWDQNGLDPHWHUIW ¨7$ DYHUDJHGDLO\DPELHQWWHPSHUDWXUHUDQJH 25 Į5 WDQNURRIVXUIDFHVRODUDEVRUSWDQFHGLPHQVLRQOHVV Į6 WDQNVKHOOVXUIDFHVRODUDEVRUSWDQFHGLPHQVLRQOHVV , DYHUDJHGDLO\WRWDOLQVRODWLRQIDFWRU%WXIW GD\ $3,DVVLJQVDGHIDXOWYDOXHRI+6' DQGDQDVVXPSWLRQRIĮ5 Į6UHVXOWLQJLQWKHVLPSOLILHGHTXDWLRQ IRUDQXQLQVXODWHGWDQN οܶ௏ ൌ ͲǤ͹οܶ஺ ൅ ͲǤͲʹߙܫ :KHUH Į DYHUDJHWDQNVXUIDFHVRODUDEVRUSWDQFHGLPHQVLRQOHVV 7KHYDSRUSUHVVXUHUDQJH¨39LVFDOFXODWHGIURP(TXDWLRQ οܲ௏ ൌܲ௏௑ െܲ௏ே .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW :KHUH 39;DQG391DUHWKHYDSRUSUHVVXUHVDW7/;DQG7/1UHVSHFWLYHO\ 9DSRU6SDFH2XWDJH+92 )RUKRUL]RQWDOWDQNVWKHYDSRUVSDFHRXWDJH+92LVHVWLPDWHGDV ܪ௏ை ൌ ܪா ʹ :KHUH +( HIIHFWLYHKHLJKWRIDQHTXLYDOHQWXSULJKWF\OLQGHUIW ܪா ൌ ߨ Ͷ ܦ ' GLDPHWHURIDYHUWLFDOFURVVVHFWLRQRIWKHKRUL]RQWDOWDQNIW 9HQWHG9DSRU6DWXUDWLRQ)DFWRU.6 7KHYHQWHGYDSRUVDWXUDWLRQIDFWRU.6LVFDOFXODWHGXVLQJ(TXDWLRQ ܭௌ ൌ ͳ ͳ ൅ ͲǤͲͷ͵ܲ௏஺ ܪ௏ை :KHUH .6 YHQWHGYDSRUVDWXUDWLRQIDFWRUGLPHQVLRQOHVV 39$ YDSRUSUHVVXUHDWDYHUDJHGDLO\OLTXLGWHPSHUDWXUHSVLD +92 YDSRUVSDFHRXWDJHIW 6WRFN9DSRU'HQVLW\:9 7KHGHQVLW\RIWKHYDSRU:9LVFDOFXODWHGXVLQJ(TXDWLRQ ܹ௏ ൌ ܯ௏ ܲ௏஺ ܴܶ௏ :KHUH :9 YDSRUGHQVLW\OEIW 09 YDSRUPROHFXODUZHLJKWOEOPRO 5 WKHLGHDOJDVFRQVWDQWSVLDIW OEPROH25 39$ YDSRUSUHVVXUHDWGDLO\DYHUDJHOLTXLGVXUIDFHWHPSHUDWXUHSVLD 79 DYHUDJHYDSRUWHPSHUDWXUH 25 :RUNLQJ/RVV $QQXDOIL[HGURRIWDQNZRUNLQJORVVHVDUHHVWLPDWHGXVLQJ(TXDWLRQ ܮ௪ ൌܸொ ܭே ܭ௉ ܹ௏ ܭ஻ :KHUH /Z ZRUNLQJORVVOE\U 94 QHWZRUNLQJORVVWKURXJKSXWIW \U .1 ZRUNLQJORVVWXUQRYHUVDWXUDWLRQIDFWRUGLPHQVLRQOHVV )RUWXUQRYHUV!.1 11 1 QXPEHURIWXUQRYHUVSHU\HDUGLPHQVLRQOHVV 1 49 4 DQQXDOQHWWKURXJKSXWJDO\U .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 9 ZRUNLQJYROXPHJDO .3 ZRUNLQJORVVSURGXFWIDFWRUGLPHQVLRQOHVV .S IRURUJDQLFOLTXLGVH[FHSWFUXGHRLOV :9 YDSRUGHQVLW\OEIW .% YHQWVHWWLQJFRUUHFWLRQIDFWRUGLPHQVLRQOHVV.% :KHQWKHEUHDWKHUYHQWVHWWLQJVDUHJUHDWHUWKDQWKHW\SLFDOYDOXHVRISVLJDQGWKHFRQGLWLRQ H[SUHVVHGLQ(TXDWLRQLVPHWDYHQWVHWWLQJFRUUHFWLRQIDFWRU.%PXVWEHGHWHUPLQHGXVLQJHTXDWLRQ 7KLVYDOXHRI.%ZLOOEHXVHGLQ(TXDWLRQWRFDOFXODWHZRUNLQJORVVHV 7KHUHIRUHZKHQ(TXDWLRQ ܭே ൤ܲ஻௉ ൅ܲ஺ ܲூ ൅ܲ஺ ൨൐ͳǤͲ 7KHQ(TXDWLRQEHFRPHV ܭ஻ ൌ൦ ܲூ ൅ܲ஺ܭே െܲ௏஺ ܲ஻௉ ൅ܲ஺ െܲ௏஺ ൪ :KHUH .% YHQWVHWWLQJFRUUHFWLRQIDFWRUGLPHQVLRQOHVV 3, SUHVVXUHRIWKHYDSRUVSDFHDWQRUPDORSHUDWLQJFRQGLWLRQVSVLJ 3$ DWPRVSKHULFSUHVVXUHSVLD .1 ZRUNLQJORVVWXUQRYHUVDWXUDWLRQIDFWRUGLPHQVLRQOHVV 39$ YDSRUSUHVVXUHDWWKHDYHUDJHGDLO\OLTXLGVXUIDFHWHPSHUDWXUHSVLD 3%3 EUHDWKHUYHQWSUHVVXUHVHWWLQJSVLJ 1 QXPEHURIWXUQRYHUVSHU\HDU ܰൌܳ ܥ :KHUH 4 DQQXDOWDQNWKURXJKSXWJDO\U & WDQNFDSDFLW\JDO +D]DUGRXV$LU3ROOXWDQW6SHFLDWLRQ 7KHLQGLYLGXDO+$3HPLVVLRQVIURPIL[HGURRIVWRUDJHWDQNVDUHHVWLPDWHGE\PXOWLSO\LQJWKHWRWDOORVVE\WKH ZHLJKWIUDFWLRQLQWKHYDSRUSKDVHRIWKHGHVLUHGFRPSRQHQWXVLQJ(TXDWLRQ ܮ ்௜ ൌሺܼ௏௜ ሻሺܮ் ሻ :KHUH /7L HPLVVLRQUDWHRIFRPSRQHQWLOE\U =9L ZHLJKWIUDFWLRQRIFRPSRQHQWLLQWKHYDSRUSKDVHOEOE /7 WRWDOORVVHVOE\U 7KHSDUWLDOSUHVVXUH3LRIDFRPSRQHQWFDQEHGHWHUPLQHGXVLQJ5DRXOW¶V/DZZKLFKVWDWHVWKDWWKHPROH IUDFWLRQRIWKHFRPSRQHQWLQWKHOLTXLG[LPXOWLSOLHGE\WKHYDSRUSUHVVXUHRIWKHSXUHFRPSRQHQW3LV HTXDOWRWKHSDUWLDOSUHVVXUH3LRIWKDWFRPSRQHQW ܲ௜ ൌ ሺܲሻሺܺ௜ ሻ :KHUH .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 3L SDUWLDOSUHVVXUHRIFRPSRQHQWLSVLD 3 YDSRUSUHVVXUHRISXUHFRPSRQHQWLDWWKHDYHUDJHGDLO\OLTXLGVXUIDFHWHPSHUDWXUH SVLD [L OLTXLGPROHIUDFWLRQOEPROHOEPROH 7KHYDSRUSUHVVXUHRIHDFKFRPSRQHQWFDQEHFDOFXODWHGIURP$QWRLQH¶VHTXDWLRQ ݔ௜ ൌ൬ܼ௅௜ ܯ௅ ܯ௜ ൰ :KHUH [L OLTXLGPROHIUDFWLRQRIFRPSRQHQWLOEPROOEPROH =/L ZHLJKWIUDFWLRQRIFRPSRQHQWLLQWKHOLTXLGOEOE 0/ PROHFXODUZHLJKWRIOLTXLGVWRFNOEOEPROH 0L PROHFXODUZHLJKWRIFRPSRQHQWLOEOEPROH 7KHYDSRUPROHIUDFWLRQRIWKHFRPSRQHQWFDQEHGHWHUPLQHGIURPXVLQJ(TXDWLRQ ݕ௜ ൌ ܲ௜ ܲ௏஺ :KHUH \L YDSRUPROHIUDFWLRQRIFRPSRQHQWLOEPROOEPRO 3L SDUWLDOSUHVVXUHRIFRPSRQHQWLSVLD 39$ WRWDOYDSRUSUHVVXUHRIOLTXLGPL[WXUHSVLD 7KHZHLJKWIUDFWLRQVLQWKHYDSRUSKDVHDUHFDOFXODWHGIURPWKHPROHIUDFWLRQVLQWKHYDSRUSKDVH ܼ௏௜ ൌ൬ݕ௜ ܯ௜ ܯ௩ ൰ :KHUH =9L YDSRUZHLJKWIUDFWLRQRIFRPSRQHQWLOEOE \L YDSRUPROHIUDFWLRQRIFRPSRQHQWLOEPROHOEPROH 0L PROHFXODUZHLJKWRIFRPSRQHQWLOEOEPROH 09 PROHFXODUZHLJKWRIYDSRUVWRFNOEOEPROH .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 4.126RXUFH6L]H'HWHUPLQDWLRQ 7KHUHVXOWVRIFULWHULDSROOXWDQWHPLVVLRQFDOFXODWLRQVGRQHIRU.LOJRUH¶V%HQMDPLQ3LWDUHFRPSDUHGDJDLQVW PDMRUVRXUFHWKUHVKROGVLQ7DEOHEHORZ7KHHPLVVLRQVSUHVHQWHGDUHRQO\IRUWKH%HQMDPLQ3LW .LOJRUH¶V%HQMDPLQ3LWLVORFDWHGLQDQDUHDRIQRQDWWDLQPHQWIRU30DQGR]RQHEXWLQDWWDLQPHQWDUHDIRU DOORWKHUSROOXWDQWV$VSUHYLRXVO\PHQWLRQHG12;6292&VDQGDPPRQLDDUHDOOSUHFXUVRUVRI30$V SUHVHQWHGLQWKHWDEOHEHORZQRQHRIWKHSURSRVHGHPLVVLRQVDW.LOJRUH¶V%HQMDPLQ3LWDUHJUHDWHUWKDQ PDMRUVRXUFHWKUHVKROGVLHWS\IRUDQ\FULWHULDSROOXWDQWZLWKH[FHSWLRQWRGLUHFW30DQGLWV SUHFXUVRUVIRUZKLFKWKHPDMRUVRXUFHWKUHVKROGLVWS\WS\IRUDQ\+$3WS\IRUDOO+$3VFRPELQHG DQGWS\IRU&2H7KHUHIRUH.LOJRUH¶V%HQMDPLQ3LWZLOOFRQWLQXHWREHFODVVLILHGDVDPLQRUVRXUFH 7DEOH3URSRVHG3URMHFW(PLVVLRQV9HUVXV0DMRU6RXUFH7KUHVKROGV 5RZ(PLVVLRQVWS\ ,'303012;&26292&&2H &UXVKLQJDQG6FUHHQLQJ2SHUDWLRQV 0.23 0.06 0.00 0.00 0.000.00 0.00 6WRFNSLOHVDQG'LVWXUEHG*URXQGV 2.07 1.22 0.00 0.00 0.000.00 0.00 %XOOGR]HUVDQG'URSV 0.28 0.04 0.00 0.00 0.000.00 0.00 'ULOOLQJDQG%ODVWLQJ 0.03 1.54E-03 0.03 0.67 5.92E-050.00 0.00 5RDGV 1.92 0.19 0.00 0.00 0.000.00 0.00 7DQNV 0.00 0.00 0.00 0.00 0.000.04 6LORV 0.02 0.02 0.00 0.06 0.000.34 +RW2LO+HDWHU 0.03 0.02 0.55 ( 0.00 181.91 'UXP0L['U\HU 0.46 0.61 2.60 1.160.64 248.67 3URMHFW6XP5.04 2.01 1.18 3.38 1.16 1.03 430.58 6LWHZLGH37(18.40 7.71 4.44 19.22 7.25 6.19 3,041.59 3HUPLWWHG(PLVVLRQV12.80 5.43 6.41 16.29 4.95 5.17 5,241.00 3HUPLW&KDQJH5.60 2.28 -1.97 2.93 2.30 1.02 -2,199.41 0DMRU6RXUFH7KUHVKROGV 7KUHVKROG([FHHGHG"1R 1R 1R 1R 1R 1R 1R 1+DQG+$3VHPLVVLRQVZHUHFRQVLGHUHGLQ.LOJRUH¶V%HQMDPLQ3LW¶VIDFLOLW\ZLGHHPLVVLRQVKRZHYHUWKHVH HPLVVLRQVDUHQRWDSSOLFDEOHDVVLWHSRZHULVSURYLGHGE\OLQHSRZHUDQGWKHUHDUHQRRWKHUVRXUFHVRI1+RU+$3V 9DOXHVDUHSHU8$&5ELL 7DEOHVKRZVDEUHDNGRZQRIHPLVVLRQVSHUVRXUFHUHVXOWLQJIURPWKLVSURMHFWLHIURPWKHSURMHFW LQFUHDVHURZV7KHVHYDOXHVZHUHFDOFXODWHGXVLQJ8'$4¶VDQG(3$¶VPRVWXSWRGDWH()VDQG JXLGDQFH7KHVXPRIWKHVHHPLVVLRQVUHVXOWVLQWKH3URMHFW6XPURZWKLVLVWKHLQFUHDVHLQHPLVVLRQV UHVXOWLQJIURPWKHSURMHFWDVGHVFULEHGE\WKHPHWKRGVGHWDLOHGLQWKLV12,DLUSHUPLWDSSOLFDWLRQ7KH6LWH ZLGH37(URZVKRZVWKHFULWHULDSROOXWDQWHPLVVLRQVIRUWKHHQWLUH%HQMDPLQ3LWZKRVHH[LVWLQJ HPLVVLRQVRXUFHVZHUHFDOFXODWHGXVLQJWKHPHWKRGVGHVFULEHGLQWKLV12,DLUSHUPLWDSSOLFDWLRQLH6LWH ZLGH37(URZVKRZVWKHHPLVVLRQVUHVXOWLQJIURPWKHRSHUDWLRQVDVVRFLDWHGZLWKSURGXFLQJ WS\RIDJJUHJDWHWS\RI+0$DQGDFUHVRIVWRFNSLOHVDQGGLVWXUEHGJURXQGXVLQJ8'$4¶VDQG (3$¶VPRVWXSWRGDWH()VDQGJXLGDQFH7KHVHDUHWKHYDOXHVWKDWZHUHXVHGIRUWKHDLUGLVSHUVLRQ PRGHOLQJDQDO\VLVZKLFKZLOOEHVXEPLWWHGXQGHUDVHSDUDWHVXEPLWWDO 7KH3HUPLWWHG(PLVVLRQVURZVKRZVWKHYDOXHVRIWKHHPLVVLRQVFXUUHQWO\SHUPLWWHGLQ%HQMDPLQ¶V$2 '$4($17KHVHYDOXHVZHUHFDOFXODWHGKLVWRULFDOO\DQGLWLVXQFOHDUZKLFK()VRUUHJXODWRU\ JXLGDQFHZHUHXVHG7KH3HUPLW&KDQJHURZVKRZVWKHGLIIHUHQFHEHWZHHQWKH6LWHZLGH37(URZ .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW DQGWKH3HUPLWWHG(PLVVLRQVURZ%HFDXVHWKHPRVWXSWRGDWH()VDQGJXLGDQFHIURP8'$4DQG(3$ ZHUHXVHGLQWKLV12,DLUSHUPLWDSSOLFDWLRQEXWSHUKDSVQRWLQWKHSUHYLRXVWKH3URMHFW6XPURZ UHVXOWVLQWKH3HUPLW&KDQJHURZ $VWKH6LWHZLGH37(URZFRQWDLQVWKHHPLVVLRQVUHVXOWLQJIURPWKHXVHRIWKHPRVWXSWRGDWH()VLWLV UHTXHVWHGWKDWWKRVHHPLVVLRQVEHXVHGDVWKHQHZVLWHZLGH37(WKDWZLOOEHUHFRUGHGLQWKHXSGDWHG$2 7KLVDSSURDFKRIDFFRXQWLQJIRUHPLVVLRQVLVUHTXHVWHGLQRUGHUWRIDFLOLWDWHWKHKLJKHVWGHJUHHRIDFFXUDF\ WRWKHVLWH¶VHPLVVLRQVDVGHYHORSHGXQGHU8'$4¶VDQG(3$¶VPRVWUHFHQWJXLGDQFH .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW %(67$9$,/$%/(&21752/7(&+12/2*<%$&7$1$/<6,6 ,QWKH6WDWHRI8WDKXQGHU5G1RWLFHRI,QWHQWHYHU\IDFLOLW\RSHUDWLRQRUSURFHVVWKDW SURSRVHVDQ\DFWLYLW\WKDWZRXOGHPLWDQDLUFRQWDPLQDQWPXVWFRQVLGHU%$&7IRUWKHSURSRVHGDFWLYLW\7KH %$&7DQDO\VLVEHORZZDVSHUIRUPHGSXUVXDQWWRWKLVUXOH,WRQO\DGGUHVVHVXQLWVZKLFKZLOOEHPRGLILHG LQVWDOOHGRURWKHUZLVHDOWHUHGDFFRUGLQJWRWKLV12, 5.1&UXVKLQJDQG6FUHHQLQJ$JJUHJDWH2SHUDWLRQV 30DQG30(PLVVLRQV .LOJRUH¶V%HQMDPLQ3LWKDVRQHFUXVKLQJDQGVFUHHQLQJRSHUDWLRQIRUDJJUHJDWHPLQHGRQVLWH&UXVKLQJ DQG6FUHHQLQJFLUFXLWDQGRQHVFDOSLQJVFUHHQIRUUDZPDWHULDOVXVHGLQWKHSURGXFWLRQRI+0$7KH HTXLSPHQWDVVRFLDWHGZLWKWKHVHRSHUDWLRQVLQFOXGHWKHIROORZLQJFODVVLILFDWLRQV Ź&UXVKHUV Ź6FUHHQV Ź&RQYH\RUWUDQVIHUSRLQWV Ź6WDFNHUV 7KLV%$&7DQDO\VLVKDVEHHQFRPSOHWHGIRUDOOPDWHULDOKDQGOLQJRSHUDWLRQVZLWKLQWKH&UXVKLQJDQG 6FUHHQLQJFLUFXLWDQGWKH+0$6FUHHQLQJFLUFXLW 0DWHULDO+DQGOLQJ30DQG306WHS±,GHQWLI\$OO&RQWURO7HFKQRORJLHV &RQWUROWHFKQRORJLHVLGHQWLILHGIRU30DQG30HPLVVLRQVIURPPDWHULDOKDQGOLQJRSHUDWLRQVDUHDV IROORZVEDVHGRQ-DQXDU\UHYLHZRIUHOHYDQWHQWULHVLQ(3$¶V5$&7%$&7/$(5&OHDULQJKRXVH 5%/& Ź%DJKRXVH)DEULF)LOWHU Ź&\FORQH Ź(OHFWURVWDWLF3UHFLSLWDWRU Ź(QFORVXUHV Ź0DQDJHPHQW2SHUDWLRQ3UDFWLFHV Ź:DWHULQJDQG0DWHULDO0RLVWXUH&RQWHQW Ź:HW6FUXEEHU 0DWHULDO+DQGOLQJ30DQG306WHS±(OLPLQDWH7HFKQLFDOO\,QIHDVLEOH2SWLRQV %DJKRXVH)DEULF)LOWHU )DEULFILOWHUVEDJKRXVHVDUHXVHGIRUPHGLXPDQGORZJDVIORZVWUHDPVZLWKKLJKSDUWLFXODWH FRQFHQWUDWLRQV7KHW\SLFDOEDJKRXVHKDVDFRQWUROHIILFLHQF\EHWZHHQWR7KLVLVJHQHUDOO\ DFFRPSOLVKHGWKURXJKWKHLQVWDOODWLRQRIGXFWZRUNFDSWXUHKRRGVIDQVPRWRUVVWDUWHUVVWDFNVDQGRWKHU VWDWLRQDU\HTXLSPHQW0DWHULDODW.LOJRUH¶V%HQMDPLQ3LWWUDYHOVWKURXJKDVHULHVRIPRELOHFRQYH\RUVWKDW H[WHQGKXQGUHGVRIIHHW7KH&UXVKLQJDQG6FUHHQLQJFLUFXLWUHTXLUHVIOH[LELOLW\WRDOWHURQVLWHVWRFNSLOH FRQILJXUDWLRQVDQGWKHORFDWLRQRIFUXVKLQJDQGVFUHHQLQJRSHUDWLRQVLHWKH&UXVKLQJDQG6FUHHQLQJ FLUFXLW¶VHTXLSPHQWPXVWUHPDLQPRELOH7KLVFRQILJXUDWLRQLVLQFRPSDWLEOHZLWKVWDWLRQDU\EDJKRXVH HTXLSPHQWDQGWKXVUHQGHUVWKHXVHRIDEDJKRXVHWHFKQLFDOO\LQIHDVLEOH )URP(3$$LU3ROOXWLRQ&RQWURO7HFKQRORJ\)DFW6KHHWIRUEDJKRXVHV(3$) .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 7KHELQKRSSHUVDVVRFLDWHGZLWKWKH+0$3ODQWZLOOUHPDLQVWDWLRQDU\+RZHYHUDEDJKRXVHLVFRQVLGHUHG WHFKQLFDOO\LQIHDVLEOHDVDFRQWUROWHFKQRORJ\EHFDXVHRIWKHGLIILFXOW\LQFDSWXULQJIXJLWLYHHPLVVLRQVGXULQJ ELQORDGLQJ+RRGVZRXOGKDYHWREHSODFHGDERYHHDFKELQWRFROOHFWIXJLWLYHHPLVVLRQVDQGURXWHWKHPWR WKHEDJKRXVH\HWWKHKHLJKWDWZKLFKWKH\ZRXOGQHHGWREHLQVWDOOHGWRDOORZIRUELQORDGLQJE\IURQWHQG ORDGHUV!IHHWZRXOGGLPLQLVKDKRRG¶VFDSWXUHHIILFLHQF\WRWKHSRLQWRIEHLQJUHQGHUHGLQHIIHFWLYH $SHUPDQHQWWRWDOHQFORVXUHZRXOGEHUHTXLUHGWREHLQVWDOOHGLQRUGHUWRFDSWXUHWKHIXJLWLYHHPLVVLRQVDQG WKHQURXWHWKHPWRDEDJKRXVH7KLVLVFRQVLGHUHGWHFKQLFDOO\LQIHDVLEOHIRUWKLVW\SHRIRSHUDWLRQ 7KHUHIRUHDEDJKRXVHLVFRQVLGHUHGWHFKQLFDOO\LQIHDVLEOHIRUWKHELQV 5$3PDWHULDOSURFHVVHGE\WKHVFDOSLQJVFUHHQKDVDQDWXUDOO\KLJKWDUFRQWHQW'XHWRWKHDGKHVLYHQDWXUH RIWDUEDJVZLWKLQWKHEDJKRXVHZRXOGEHFRPHFRDWHGZLWKWDUDVLWLVLQWURGXFHGWRWKHEDJV7KHUHVXOWLQJ FDNHRQWKHEDJVZRXOGFDXVHODUJHSUHVVXUHGURSVDFURVVWKHIDEULF$VDUHVXOWDODUJHDLUWRFORWKUDWLR LHWKHUDWLRRIWKHYROXPHWULFDLUIORZWRFORWKDUHDZRXOGEHUHTXLUHGUHGXFLQJWKHFRQWURORI30IURP WKHUHVWRIWKH+0$SODQW7KHXVHRIDEDJKRXVHIRUWKHVFDOSLQJVFUHHQLVWKHUHIRUHWHFKQLFDOO\LQIHDVLEOH IRU30UHPRYDODQGLVWKHUHIRUHQRWFRQVLGHUHG%$&7 &\FORQH $F\FORQHVHSDUDWRUF\FORQHRSHUDWHVRQWKHSULQFLSOHRIFHQWULIXJDOVHSDUDWLRQ$KLJKHIILFLHQF\F\FORQH GHVLJQHGVSHFLILFDOO\IRU30DQG30UHPRYDOLVOLNHO\WRDFKLHYHEHWZHHQWRUHPRYDOIRU30 DQGWRUHPRYDOIRU30/LNHDEDJKRXVHF\FORQHIHDVLELOLW\LVEDVHGRQURXWLQJHPLVVLRQVWRD VWDWLRQDU\FRQWUROV\VWHPYLDGXFWZRUNFDSWXUHKRRGVIDQVHWF7KLVFDYHDWUHVXOWVLQDF\FORQHEHLQJ WHFKQLFDOO\LQIHDVLEOHIRUWKH&UXVKLQJDQG6FUHHQLQJFLUFXLWDVWKHFUXVKLQJDQGVFUHHQLQJHTXLSPHQWXVHG IRUSURGXFWLRQDUHPRELOH 7KHELQKRSSHUVDVVRFLDWHGZLWKWKH+0$3ODQWZLOOUHPDLQVWDWLRQDU\+RZHYHUDF\FORQHLVFRQVLGHUHG WHFKQLFDOO\LQIHDVLEOHDVDFRQWUROWHFKQRORJ\IRUWKHVDPHUHDVRQDVWKDWOLVWHGIRUWKHEDJKRXVHDERYH $F\FORQHLVWHFKQLFDOO\LQIHDVLEOHIRUWKHVWDWLRQDU\VFDOSLQJVFUHHQEHFDXVHVLPLODUWRWKHH[SODQDWLRQJLYHQ IRUWKHEDJKRXVHWKHKLJKWDUFRQWHQWRI5$3ZRXOGFORJDF\FORQHUHGXFLQJRUQHJDWLQJLWVFRQWURO HIILFLHQF\ (OHFWURVWDWLF3UHFLSLWDWRU $GU\HOHFWURVWDWLFSUHFLSLWDWRU(63LVDSDUWLFOHFRQWUROGHYLFHWKDWXVHVHOHFWULFDOIRUFHVWRPRYHFRDUVH SDUWLFOHVDWKLJKFRQFHQWUDWLRQVRXWRIDJDVVWUHDPDQGRQWRFROOHFWRUSODWHVDQGWKHQLQWRDKRSSHU7KLV UHPRYDOHIILFLHQF\LVW\SLFDOO\EHWZHHQ(63VDUHVHQVLWLYHWRYDULDWLRQVLQJDVVWUHDPVDQGGR QRWZRUNZHOOZLWKVWUHDPVWKDWDUHKLJKO\YDULDEOHVXFKDVWKRVHSUHVHQWLQFUXVKLQJDQGVFUHHQLQJ 7KHUHIRUHLPSOHPHQWDWLRQRIWKLVFRQWUROWHFKQRORJ\LVFRQVLGHUHGWHFKQLFDOO\LQIHDVLEOHIRUDOOFUXVKLQJDQG VFUHHQLQJVRXUFHV 7KHELQKRSSHUVDVVRFLDWHGZLWKWKH+0$3ODQWZLOOUHPDLQVWDWLRQDU\+RZHYHUDQ(63LVFRQVLGHUHG WHFKQLFDOO\LQIHDVLEOHDVDFRQWUROWHFKQRORJ\IRUWKHVDPHUHDVRQDVWKDWOLVWHGIRUWKHEDJKRXVHDERYH $Q(63LVWHFKQLFDOO\LQIHDVLEOHIRUWKHVWDWLRQDU\VFDOSLQJVFUHHQEHFDXVHVLPLODUWRWKHH[SODQDWLRQJLYHQ IRUWKHEDJKRXVHWKHKLJKWDUFRQWHQWRI5$3ZRXOGFORJDQ(63UHGXFLQJRUQHJDWLQJLWVFRQWUROHIILFLHQF\ $YHUDJHGLPHQVLRQRIKLJKOLIWRI&$7¶VPHGLXPZKHHOORDGHUVWKRVHXVHGDWWKH%HQMDPLQ3LW )URP$LU3ROOXWLRQ&RQWURO7HFKQRORJ\)DFW6KHHWIRUF\FORQHV(3$) )URP(3$$LU3ROOXWLRQ&RQWURO7HFKQRORJ\)DFW6KHHWIRU&UXVKLQJDQG6FUHHQLQJ(OHFWURVWDWLF3UHFLSLWDWRUV(3$) ,ELG .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW (QFORVXUHV (QFORVXUHVFRQILQHHPLVVLRQVWRWKHHQFORVHGDUHDSURKLELWLQJ30IURPUHDFKLQJDPELHQWDLU(QFORVXUHVDUH W\SLFDOO\DEOHWRDFKLHYHDFRQWUROHIILFLHQF\RIRIIXJLWLYHHPLVVLRQV$OWKRXJKHIIHFWLYHLQGXVWULDO HQFORVXUHVDUHSHUPDQHQWVWUXFWXUHV$VGLVFXVVHGWKH&UXVKLQJDQG6FUHHQLQJFLUFXLWRSHUDWHVZLWKPRELOH HTXLSPHQWZKLFKUHTXLUHVIOH[LELOLW\RIVWRFNSLOHFRQILJXUDWLRQV7KHUHIRUHHQFORVXUHVDUHWHFKQLFDOO\ LQIHDVLEOHDVDFRQWUROWHFKQRORJ\IRULWVHTXLSPHQW3DUWLDOHQFORVXUHVDUHFRQVLGHUHGWHFKQLFDOO\IHDVLEOH KRZHYHUIRUWKHVWDWLRQDU\VFDOSLQJVFUHHQDQGELQKRSSHUVDQGDUHHPSOR\HGRQERWKW\SHVRIXQLWV 0DQDJHPHQW2SHUDWLRQ3UDFWLFHV 0DQDJHPHQWSUDFWLFHVGXULQJPDWHULDOPRYHPHQWVXFKDVPLQLPL]LQJGURSKHLJKWVZLOOPLQLPL]H30DQG 30HPLVVLRQVDQGZLOOEHLPSOHPHQWHGLQWKLVSURMHFW%HVWRSHUDWLQJSUDFWLFHVVXFKDVUHJXODULQVSHFWLRQ DQGPDLQWHQDQFHZLOOEHLPSOHPHQWHGDVZHOO :DWHULQJDQG0DWHULDO0RLVWXUH&RQWHQW :DWHULQJFKDQJHVWKHSK\VLFDOSURSHUWLHVRIWKHVXUIDFHPDWHULDOE\ELQGLQJVRLOSDUWLFOHVWRJHWKHUVXFKWKDW IXJLWLYHHPLVVLRQVDUHPLQLPL]HGRUQRWJHQHUDWHG0RUHRYHUFDUU\RYHURIPDWHULDOPRLVWXUHFRQWHQWIURP ZDWHUVSUD\VPLWLJDWHVSDUWLFXODWHHPLVVLRQVEH\RQGWKHLQLWLDOSRLQWRIZDWHULQJ,QKHUHQWPRLVWXUHIRXQGLQ PLQHGDJJUHJDWHDFKLHYHVWKHVDPHHIIHFWDVZHWWLQJE\ZDWHULQJFRQWUROV:HWVXSSUHVVLRQLVVKRZQWR DFKLHYHEHWZHHQFRQWURORIHPLVVLRQV:HWVXSSUHVVLRQLVGRQHWKURXJKLPSOHPHQWDWLRQRIDKLJK SUHVVXUHZDWHULQJV\VWHPWKDWLVXQLTXHWRWKH%HQMDPLQ3LW%HFDXVHRIWKHKLJKTXDOLW\DQGHIILFLHQF\RI WKHZDWHULQJV\VWHPLWLVDVVXPHGWKDWWKHFRQWUROHIILFLHQF\LVKLJKHUWKDQWKHDYHUDJHWUDGLWLRQDOO\ XVHGDW.LOJRUH¶VIDFLOLWLHV7KLVFRQWUROPHDVXUHLVFRQVLGHUHGWHFKQLFDOO\IHDVLEOHIRUPDWHULDOKDQGOLQJ :HW6FUXEEHU :HWJDVVFUXEEHUVFDQDFKLHYHFRQWURORI30HPLVVLRQV+RZHYHUWKH\IDFHWKHVDPHGLIILFXOWLHV LQPRELOHPLQLQJIDFLOLWLHVDVEDJKRXVHVDQGF\FORQHVQDPHO\WKH\UHO\RQVWDWLRQDU\GXFWZRUNDQGRWKHU HTXLSPHQWWRURXWHHPLVVLRQVWRWKHVFUXEEHULWVHOI'XHWRWKHQDWXUHRIPLQLQJFRQYH\RUVOHDGLQJWR FUXVKLQJVFUHHQLQJDQGGURSSRLQWVZLOOEHPRYHGWKURXJKRXWWKHOLIHRIWKHPLQH7KHLQFRPSDWLELOLW\ EHWZHHQWKHPRELOHFUXVKLQJDQGVFUHHQLQJHTXLSPHQWDQGVWDWLRQDU\ZHWVFUXEEHUHTXLSPHQWUHQGHUVWKH XVHRIDZHWVFUXEEHUWHFKQLFDOO\LQIHDVLEOHLQWKH&UXVKLQJDQG6FUHHQLQJFLUFXLW :HWVFUXEEHUVDUHFRQVLGHUHGWHFKQLFDOO\LQIHDVLEOHIRUWKHVWDWLRQDU\VFDOSLQJVFUHHQDQGELQKRSSHUVLQWKH +0$SRUWLRQRIWKH%HQMDPLQ3LWIRUWKHVDPHUHDVRQVOLVWHGIRUWKHEDJKRXVHF\FORQHDQG(63DERYH 0DWHULDO+DQGOLQJ30DQG306WHS±5DQN5HPDLQLQJ&RQWURO7HFKQRORJLHVE\&RQWURO (IIHFWLYHQHVV 7DEOH30DQG30&RQWUROIRU0DWHULDO+DQGOLQJLQWKH&UXVKLQJDQG6FUHHQLQJ&LUFXLW &RQWURO7HFKQRORJLHV5DQN3HUFHQW&RQWURO)HDVLEOH%$&7 :DWHU6SUD\,QKHUHQW3URSHUWLHV ± <HV <HV %HVW0DQDJHPHQW2SHUDWLRQDO3UDFWLFHV 9DULDEOH <HV <HV 7H[DV&RPPLVVLRQRQ(QYLURQPHQWDO4XDOLW\0DWHULDO+DQGOLQJ6RXUFH7\SHV&RQWUROV(PLVVLRQ&DOFXODWLRQVIRU PHFKDQLFDOFRQYH\DQFHS )URP:HVWHUQ5HJLRQDO$LU3DUWQHUVKLS)XJLWLYH'XVW+DQGERRN([HFXWLYH6XPPDU\S6HSWHPEHU )URP(3$$LU3ROOXWLRQ&RQWURO7HFKQRORJ\)DFW6KHHWIRU3DFNHG%HG3DFNHG7RZHU:HW6FUXEEHU(3$) .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 7DEOH30DQG30&RQWUROIRU0DWHULDO+DQGOLQJ6FDOSLQJ6FUHHQDQG%LQ+RSSHUV &RQWURO7HFKQRORJLHV5DQN 3HUFHQW&RQWURO )HDVLEOH%$&7 :DWHULQJDQG0DWHULDO0RLVWXUH&RQWHQW <HV <HV (QFORVXUHV <HV <HV %HVW0DQDJHPHQW2SHUDWLRQDO3UDFWLFHV 9DULDEOH <HV <HV 7KHVHRSHUDWLRQVDUHVXEMHFWWR16366XESDUW2226WDQGDUGVRI3HUIRUPDQFHIRU1RQPHWDOOLF0LQHUDO 3URFHVVLQJ3ODQWV10337KHVH1636VWDQGDUGVZHUHXSGDWHGE\WKH(3$LQ6HFWLRQRIWKH &OHDQ$LU$FW&$$UHTXLUHVWKDW1636UHIOHFWWKHDSSOLFDWLRQRIWKHEHVWV\VWHPRIHPLVVLRQUHGXFWLRQV WDNLQJLQWRFRQVLGHUDWLRQWKHFRVWRIDFKLHYLQJVXFKUHGXFWLRQVQRQDLUTXDOLW\KHDOWKLPSDFWHQYLURQPHQWDO LPSDFWDQGHQHUJ\UHTXLUHPHQWV,QWKLVDPHQGPHQW(3$PDGHUHYLVLRQVWRWKHHPLVVLRQOLPLWVIRU1033 DIIHFWHGIDFLOLWLHVZKLFKFRPPHQFHFRQVWUXFWLRQPRGLILFDWLRQRUUHFRQVWUXFWLRQDIWHUSXEOLVKLQJWKHUHYLVHG UXOHV(3$¶VUHYLHZRISHUPLWVDQGRWKHUDYDLODEOHLQIRUPDWLRQZKHQUHYLVLQJWKHVHVWDQGDUGVRISHUIRUPDQFH GLGQRWUHYHDODQ\QHZRUHPHUJLQJSROOXWLRQSUHYHQWLRQPHDVXUHVRU30FRQWUROWHFKQRORJLHVDVEHVW GHPRQVWUDWHGWHFKQRORJLHV%'7(3$IRXQGWKDWWKH16366XESDUW222IXJLWLYHHPLVVLRQOLPLWVDUHPRVW FRPPRQO\PHWWKURXJKXVHRIZHWVXSSUHVVLRQDVQHHGHGDQGZDWHUFDUU\RYHU:HWGXVWVXSSUHVVLRQ UHPDLQVWKHPHWKRGRIFKRLFHIRUWKHYDVWPDMRULW\RIFUXVKLQJDQGVFUHHQLQJIDFLOLWLHV 0DWHULDO+DQGOLQJ30DQG306WHS±(YDOXDWH0RVW(IIHFWLYH&RQWUROVDQG'RFXPHQW 5HVXOWV 7KH%'7FRQWUROV\VWHPVLGHQWLILHGLQ(3$¶V1636HYDOXDWLRQVDFKLHYHDUHGXFWLRQLQ30DQG30DORQJ ZLWKUHGXFWLRQLQODUJHU30SDUWLFOHVUHTXLUHGWRPHHW16366XESDUW222HPLVVLRQVWDQGDUGV$GGLWLRQDOO\ DV.LOJRUH¶V%HQMDPLQ3LWLVORFDWHGLQD301RQDWWDLQPHQW$UHDLWLVVXEMHFWWR5$JJUHJDWH 3URFHVVLQJ2SHUDWLRQV)XUWKHUPRUHEHFDXVHWKHVHOHFWHGWHFKQRORJLHVSURYLGHWKHKLJKHVWFRQWURO HIILFLHQFLHVIHDVLEOHIRUWKH&UXVKLQJDQG6FUHHQLQJFLUFXLWDFRVWDQDO\VLVLVQRWQHFHVVDU\7KHUHIRUH ZDWHULQJDQGEHVWPDQDJHPHQWSUDFWLFHVDUHWKHPRVWHIIHFWLYHFRQWUROWHFKQRORJLHVIRUWKHHTXLSPHQWLQ WKH&UXVKLQJDQG6FUHHQLQJFLUFXLW 0DWHULDO+DQGOLQJ30DQG306WHS±6HOHFW%$&7 .LOJRUHSURSRVHVWKDW%$&7IRUWKH&UXVKLQJDQG6FUHHQLQJFLUFXLWFRQVLVWVRIUHVWULFWLQJIXJLWLYHHPLVVLRQV WRRSDFLW\VWDQGDUGVVHWIRUWKE\16366XESDUW2226WDQGDUGVRI3HUIRUPDQFHIRU1033QDPHO\ RSDFLW\IRUEHOWFRQYH\RUVWUDQVIHUSRLQWVVFUHHQVVWRUDJHELQVDQGHQFORVHGWUXFNVDQGRSDFLW\IRU FUXVKLQJRSHUDWLRQV/LNHPDQ\FUXVKLQJDQGVFUHHQLQJIDFLOLWLHVWKLVZLOOEHGRQHE\ZDWHUDSSOLFDWLRQDQG PDWHULDOPRLVWXUHFRQWHQWFRQWUROV7KLVLQFOXGHVEXWLVQRWOLPLWHGWR Ź$SSOLFDWLRQRIZDWHUWRVWRFNSLOHVYLDZDWHUVSUD\IURPVWDFNHUVDQGRUDZDWHUWUXFN Ź$SSOLFDWLRQRIZDWHUVSUD\VWRFUXVKLQJRSHUDWLRQVDQG Ź0RLVWXUHFRQWHQWFDUU\RYHUGXULQJWUDQVSRUWDWLRQRQFRQYH\RUV )XUWKHUPRUHPDQDJHPHQWDQGEHVWRSHUDWLRQDOSUDFWLFHVZLOOEHDSSOLHG7KHVHLQFOXGHEXWDUHQRWOLPLWHG WR Ź0LQLPL]LQJGURSGLVWDQFHIRUPDWHULDOWUDQVIHUVDQG Ź3HULRGLFLQVSHFWLRQVRIPDWHULDOKDQGOLQJ 86(3$UHYLVHG16366XESDUW222LQ)HGHUDO5HJLVWHU)5$SULO .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 5.25RDG(PLVVLRQV )XJLWLYH30DQG30(PLVVLRQV 7KHUHDUHWZRSULPDU\KDXOURDGVIRURQVLWHDQGRIIVLWHVKLSPHQWVZKLFKWUDYHOIURPWKHH[WHULRURIWKH SURSHUW\WRWKHVFDOHDQGORDGLQJDUHDV3RUWLRQVRIWKHWZRKDXOURDGVDUHSDYHGZKHUHDVWKH UHPDLQGHULVXQSDYHGZLWKDURDGEDVHRIUHF\FOHGDVSKDOW0XOWLSOHXQSDYHGWUDPURXWHVIRUIURQWHQG ORDGHUPRYHPHQWDUHDOVRDFFRXQWHGIRU)XJLWLYHHPLVVLRQVDUHJHQHUDWHGIURPURDGXVHE\FXVWRPHU WUXFNVVXSSRUWYHKLFOHVDQGKHDY\HTXLSPHQWXVHGLQPLQLQJRSHUDWLRQV)XJLWLYHGXVWIURPSURGXFWLRQ DFWLYLWLHVVXFKDVORDGLQJXQORDGLQJVWRUDJHRIEXONPDWHULDOVDQGPDWHULDOWUDQVSRUWDWLRQPD\FDXVH30WR EHGHSRVLWHGRQSODQWURDGV9HKLFXODUWUDIILFLQWKHVHDUHDVPD\WKHQGLVWXUEGXVWGHSRVLWHGRQSODQWURDGV UHVXOWLQJLQPRUH30HPLVVLRQV 5RDGV30DQG306WHS,GHQWLI\$OO&RQWURO7HFKQRORJLHV &RQWUROWHFKQRORJLHVLGHQWLILHGIRU30DQG30HPLVVLRQVIURPURDGVDUHDVIROORZVEDVHGRQ0D\ UHYLHZRIUHOHYDQWHQWULHVLQ(3$¶V5%/& Ź&KHPLFDO7UHDWPHQW$SSOLFDEOHWR8QSDYHG5RDGV2QO\ Ź5HGXFHG6SHHG$SSOLFDEOHWR8QSDYHG5RDGV2QO\ Ź5RDG3DYLQJ$SSOLFDEOHWR8QSDYHG5RDGV2QO\ Ź6LOW&RQWHQW5HGXFWLRQE\5RDG%DVH$SSOLFDEOHWR8QSDYHG5RDGV2QO\ Ź6WUHHW6ZHHSLQJ$SSOLFDEOHWR3DYHG5RDGV2QO\ Ź:DWHULQJDQG0DWHULDO0RLVWXUH&RQWHQW 5RDGV30DQG306WHS±(OLPLQDWH7HFKQLFDOO\,QIHDVLEOH2SWLRQV &KHPLFDO7UHDWPHQW $SSO\LQJFKHPLFDOWUHDWPHQWWRXQSDYHGURDGVELQGVVXUIDFHSDUWLFOHVWRJHWKHUDQGLQKLELWVIXJLWLYH HPLVVLRQVE\XSWR7KLVLVIHDVLEOHIRUSHUPDQHQWKDXOURDGVEXWQRWIRUG\QDPLFSDWKVRQZKLFK EXOOGR]HUVDQGRUIURQWHQGORDGHUVRSHUDWH&KHPLFDOWUHDWPHQWDSSOLHGLQVXFKDUHDVPD\FRQWDPLQDWH PLQHGDJJUHJDWHDQGFDXVHWHFKQLFDOSUREOHPVGXULQJWKHFUXVKLQJDQGVFUHHQLQJSURFHVV)XUWKHUPRUH SURGXFWVWRFNSLOHVPD\EHFRPHFRQWDPLQDWHGDQGWKHHIIHFWVRIFKHPLFDOWUHDWPHQWDUHUHGXFHGGXHWRWKH IUHTXHQWWXUQLQJRIIURQWHQGORDGHUVZKLOHORDGLQJFXVWRPHUKDXOWUXFNV 5HGXFHG6SHHG 5HGXFLQJWKHVSHHGRQSODQWURDGVUHGXFHVWKHJHQHUDWLRQRIIXJLWLYHGXVW7KH:5$3)XJLWLYH'XVW +DQGERRNUHSRUWVWKDWDUHGXFWLRQLQHPLVVLRQVRFFXUVZKHQVSHHGVDUHUHVWULFWHGWROHVVWKDQILIWHHQ PLOHVSHUKRXUPSKDQGDUHGXFWLRQLQHPLVVLRQVZKHQVSHHGVDUHUHVWULFWHGWRPSK7KLV FRQWUROPHWKRGLVFRQVLGHUHGWHFKQLFDOO\IHDVLEOH 5RDG3DYLQJ 3DYLQJSURYLGHVHIIHFWLYHFRQWUROVRQIXJLWLYHURDGHPLVVLRQV*XLGHOLQHVIURP8'$4LQGLFDWHWKDWSDYHG URDGZD\VFRPELQHGZLWKVZHHSLQJDQGZDWHULQJSURYLGHDFRQWUROHIILFLHQF\IRUSDUWLFXODWH HPLVVLRQVWKHXVHRIDYDFXXPVZHHSHULQFUHDVHVWKHFRQWUROHIILFLHQF\WR3DYLQJURDGVLVQRW WHFKQLFDOO\IHDVLEOHQHDUG\QDPLFPLQLQJRSHUDWLRQVDW.LOJRUH¶V%HQMDPLQ3LWDVURXWHFRQILJXUDWLRQVDUH VXEMHFWWRFKDQJHDFFRUGLQJWRPLQHGHYHORSPHQW)XUWKHUPRUHHPLVVLRQVIURPSDYHGURDGVLQGLVUHSDLU 8'$4*XLGHOLQHV(PLVVLRQ)DFWRUVIRU3DYHGDQG8QSDYHG+DXO5RDGV-DQXDU\ :HVWHUQ5HJLRQDO$LU3DUWQHUVKLS)XJLWLYH'XVW+DQGERRN([HFXWLYH6XPPDU\S6HSWHPEHU 8'$4*XLGHOLQHV(PLVVLRQ)DFWRUVIRU3DYHGDQG8QSDYHG+DXO5RDGV-DQXDU\ .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW GXHWRLPSDFWIURPKHDY\HTXLSPHQWDUHKLJKHUWKDQSURSHUO\WUHDWHGXQSDYHGURDGV6LPLODUO\WKHEHQHILWV IURPDSSO\LQJFKHPLFDOGXVWVXSSUHVVDQWVDUHQHJDWHGLQDUHDVZKHUHWUXFNVWXUQDQGWUDFNHGHTXLSPHQWLV XVHGEHFDXVHWKRVHDFWLYLWLHVFDXVHFKHPLFDOGXVWVXSSUHVVDQWVWRGHWHULRUDWHPRUHTXLFNO\WKDQLVXVHIXO IHHWPLOHVRIWKHPDLQKDXOURDGVDUHFXUUHQWO\SDYHGZLWKWKHUHPDLQLQJIHHW PLOHVXQSDYHGEXWZLWKUHF\FOHGDVSKDOWIRUPLQJDURDGEDVH3DYLQJRIWKHXQSDYHGSRUWLRQVRIWKHPDLQ KDXOURDGVLVFRQVLGHUHGWHFKQLFDOO\IHDVLEOH 6LOW&RQWHQW5HGXFWLRQ 6LOWFRQWHQWUHGXFWLRQLQYROYHVFRYHULQJXQSDYHGURDGVXUIDFHVZLWKPDWHULDOWKDWKDVDORZHUVLOWFRQWHQW WKDQZKDWLVQDWXUDOO\SUHVHQWHJJUDYHORUVODJ&RPELQHGZLWKZDWHULQJWKLVPHWKRGDFKLHYHVXSWR FRQWUROHIILFLHQF\7KLVLVFRQVLGHUHGWHFKQLFDOO\IHDVLEOHDQGZLOOEHDSSOLHGZKHUHDSSURSULDWH 6WUHHW6ZHHSLQJ 6WUHHWVZHHSLQJLVDPHWKRGRI30FRQWUROWKDWXWLOL]HVDPRELOHVWUHHWVZHHSLQJXQLWWRUHPRYHORRVH PDWHULDOIURPSDYHGURDGVXUIDFHV7KLVFRQWUROWHFKQRORJ\LVWHFKQLFDOO\IHDVLEOHRQWKHSDYHGSRUWLRQVRI WKHPDLQKDXOURDGVEXWQRWRQXQSDYHGURDGVXUIDFHV7KH.LOJRUH%HQMDPLQ3LWXWLOL]HVDYDFXXPVZHHSHU RQWKHSDYHGSRUWLRQVRIWKHPDLQKDXOURDGV :DWHULQJDQG0DWHULDO0RLVWXUH&RQWHQW :DWHULQJRIKDXOURDGVUHGXFHVIXJLWLYH30DQG30HPLVVLRQVE\ELQGLQJVRLOSDUWLFOHVWRJHWKHU SUHYHQWLQJWKHLUEHLQJSLFNHGXSE\ZLQGRUYHKLFOHV:DWHULVDSSOLHGRQDVFKHGXOHGEDVLVDQG VXSSOHPHQWHGDVQHHGHGEDVHGRQGULYHUREVHUYDWLRQRIGXVWFRQGLWLRQV%DVLFZDWHULQJUHVXOWVLQDGXVW FRQWUROHIILFLHQF\RIXSWR7KLVFRQWUROWHFKQRORJ\LVFRQVLGHUHGWHFKQLFDOO\IHDVLEOHDQGZLOOEHXVHG DW.LOJRUH¶V%HQMDPLQ3LW 5RDGV30DQG306WHS±5DQN5HPDLQLQJ&RQWURO7HFKQRORJLHVE\&RQWURO(IIHFWLYHQHVV 7DEOH)XJLWLYH30DQG30&RQWURO7HFKQRORJLHVDQG(IILFLHQFLHVIRU5RDGV &RQWURO0HWKRG&RQWURO(IILFLHQF\ 3DYHG5RDG9DFXXP6ZHHSLQJDQG:DWHULQJ 3DYHG5RDG6ZHHSLQJDQG:DWHULQJ &KHPLFDO6XSSUHVVDQWDQG:DWHULQJ %DVLF:DWHULQJDQG5RDG%DVH %DVLF:DWHULQJ 5HGXFHG6SHHG )RUWKHWHFKQRORJLHVDSSOLHGWRXQSDYHGURDGVDQ\JURXSLQJRIVLOWFRQWHQWUHGXFWLRQZDWHULQJDQGVSHHG UHGXFWLRQFDQEHDSSOLHGWRJHWKHUDVWKH\DUHQRWFRPSHWLWLYH)RUWKHWHFKQRORJLHVDSSOLHGWRSDYHGURDGV VZHHSLQJDQGZDWHULQJDUHQRWFRPSHWLWLYH1RWHWKDWYDULDEOHFRQWUROWHFKQRORJLHVLQFOXGH Ź6LOW&RQWHQW5HGXFWLRQ9DULHVZLWKFXUUHQWXQFRQWUROOHGURDGFRQGLWLRQVSHU$3 ,ELG 8'$4*XLGHOLQHV(PLVVLRQ)DFWRUVIRU3DYHGDQG8QSDYHG+DXO5RDGV-DQXDU\ .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 5RDGV30DQG306WHS±(YDOXDWH0RVW(IIHFWLYH&RQWUROVDQG'RFXPHQW5HVXOWV )RUWKHSDYHGSRUWLRQVRIWKHPDLQKDXOURDGVLQFOXGLQJWKHHQWUDQFHURDGYDFXXPVZHHSLQJDQGZDWHULQJ ZLOOEHLPSOHPHQWHGWRFRQWUROIXJLWLYHGXVWHPLVVLRQVIURPWUXFNWUDIILF$VWKLVLVWKHKLJKHVWDYDLODEOH FRQWUROWHFKQRORJ\QRHFRQRPLFHQHUJHWLFRUHQYLURQPHQWDOLPSDFWHYDOXDWLRQVDUHFRQVLGHUHG )RUWKHXQSDYHGSRUWLRQVRIWKHPDLQKDXOURDGVFKHPLFDOVXSSUHVVDQWDSSOLFDWLRQZDWHUDSSOLFDWLRQDQG WKHXVHRIUHF\FOHGDVSKDOWDVDURDGEDVHDUHXVHGLQFRQMXQFWLRQRQHZLWKDQRWKHUWRDFKLHYHWKHKLJKHVW SRVVLEOHFRQWUROHIILFLHQF\IRUXQSDYHGURDGV$VWKLVLVWKHKLJKHVWDYDLODEOHFRQWUROWHFKQRORJ\QR HFRQRPLFHQHUJHWLFRUHQYLURQPHQWDOLPSDFWHYDOXDWLRQVDUHFRQVLGHUHG 5RDGV30DQG306WHS±6HOHFW%$&7 )XJLWLYHURDGHPLVVLRQVDUHJHQHUDWHGIURPURDGXVHE\FXVWRPHUWUXFNVHPSOR\HHYHKLFOHVDQGIURQWHQG ORDGHUV%$&7IRUWKHSDYHGSRUWLRQVRIWKHKDXOURDGVLVFRQVLGHUHGWRFRQVLVWRISDYLQJYDFXXPVZHHSLQJ DQGZDWHUDSSOLFDWLRQ%$&7IRUWKHXQSDYHGSRUWLRQVRIWKHKDXOURDGVLVFRQVLGHUHGWRFRQVLVWRIWKH FXUUHQWFRPELQDWLRQRIFKHPLFDODSSOLFDWLRQZDWHULQJDQGVLOWFRQWHQWUHGXFWLRQ$GGLWLRQDOO\E\XVLQJ5$3 DVDURDGEDVHWRPLQLPL]HIXJLWLYHGXVWDVSUDFWLFDO%$&7IRUQRQSHUPDQHQWURDGV±HJORDGHUWUDP URXWHV±LVFRQVLGHUHGWRFRQVLVWRIZDWHULQJDQGVLOWFRQWHQWUHGXFWLRQE\XVLQJ5$3DVDURDGEDVHWR PLQLPL]HIXJLWLYHGXVW.LOJRUH¶V%HQMDPLQ3LWZLOOLPSOHPHQWWKHVHFRQWUROV 5.3'ULOOLQJDQG%ODVWLQJ 12;&262DQG92&V±%ODVWLQJ %ODVWLQJRSHUDWLRQVLQFRUSRUDWHFRPEXVWLRQRIFRPSRXQGVFRQWDLQLQJDPPRQLXPQLWUDWHLQRUGHUWR SXOYHUL]HPDWHULDOLQWKHPLQLQJDUHD%ODVWLQJRSHUDWLRQVZLOOSURGXFHIXJLWLYH12;&262DQG92& HPLVVLRQV+RZHYHUWKHUHDUHQRFRQWUROWHFKQRORJLHVWKDWFDQEHXVHGWRPLWLJDWHWKHVHHPLVVLRQV DVVRFLDWHGZLWKEODVWLQJ$VVXFKQR%$&7DQDO\VLVKDVEHHQFRQGXFWHGIRUWKHVHHPLVVLRQV 30DQG30±'ULOOLQJDQG%ODVWLQJ 'ULOOLQJDQGEODVWLQJPHWKRGVORRVHQUDZPDWHULDOVLQWKHPLQLQJDUHDLQRUGHUWRDFFHVVWKHGHVLUHG DJJUHJDWHHPEHGGHGLQWKHJURXQG7KHVHDFWLYLWLHVFUHDWHIXJLWLYHGXVW'ULOOLQJDQGEODVWLQJRSHUDWLRQVDUH GRQHDWWKH%HQMDPLQ3LWQRWE\.LOJRUHEXWE\DWKLUGSDUW\RUJDQL]DWLRQ.LOJRUHLQGLFDWHVWKHGHVLUHG TXDQWLW\RIGULOOLQJDQGEODVWLQJWREHGRQHDQGWKHWKLUGSDUW\RUJDQL]DWLRQJRHVDERXWFRPSOHWLQJWKH RSHUDWLRQV.LOJRUHWKHUHIRUHGRHVQRWKDYHFRQWURORYHUWKHW\SHRIFRQWUROHTXLSPHQWRSHUDWLRQVWKDWDUH XWLOL]HGGXULQJGULOOLQJDQGEODVWLQJRSHUDWLRQV 'ULOOLQJ %ODVWLQJ30DQG306WHS±,GHQWLI\$OO&RQWURO7HFKQRORJLHV &RQWUROWHFKQRORJLHVLGHQWLILHGIRU30DQG30HPLVVLRQVIURPGULOOLQJDQGEODVWLQJKDYHEHHQLGHQWLILHG XVLQJWKHIROORZLQJVRXUFHV Ź8WDK'LYLVLRQRI$LU4XDOLW\)XJLWLYH'XVW&RQWURO3ODQV5HYLVHG%03 Ź'XVW&RQWURO+DQGERRNIRU,QGXVWULDO0LQHUDOV0LQLQJDQG3URFHVVLQJ1,26+-DQXDU\ Ź:5$3)XJLWLYH'XVW+DQGERRN&RXQWHVV(QYLURQPHQWDO6HSWHPEHU .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 7KHIROORZLQJPHWKRGVKDYHEHHQLGHQWLILHGDVFRQWUROWHFKQRORJLHVWRUHGXFHIXJLWLYHGXVWHPLVVLRQVIURP GULOOLQJDQGEODVWLQJ Ź$SSO\DVKURXGWRWKHGULOOLQJHTXLSPHQW Ź$SSO\EHVWPDQDJHPHQWDQGRSHUDWLRQDOSUDFWLFHVIRUGULOOLQJDQGEODVWLQJ Ź,QVWDOODGXVWFROOHFWLRQV\VWHPRQGULOOLQJHTXLSPHQWDQG Ź,QVWDOODZDWHUVSUD\RQGULOOLQJHTXLSPHQWLHXVHRIZHWGULOOLQJSUDFWLFHV 'ULOOLQJ %ODVWLQJ30DQG306WHS±(OLPLQDWH7HFKQLFDOO\,QIHDVLEOH2SWLRQV 6KURXG$SSOLFDWLRQWR'ULOOLQJ(TXLSPHQW ,QVWDOOLQJDVKURXGDWWKHGULOOLQJORFDWLRQLVRQHFRPPRQPHWKRGIRUFRQWUROOLQJIXJLWLYHGXVWHPLVVLRQVIURP GULOOLQJRSHUDWLRQV6KURXGVFDQYDU\LQVKDSHUHFWDQJXODUYVFLUFXODUDQGFRPSOH[LW\LQRUGHUWRDGDSWWR PLQLQJRSHUDWLRQV:KHQLQVWDOOHGDQGUHSODFHGFRUUHFWO\VKURXGVFDQFRQWURORIIXJLWLYHGXVW HPLVVLRQV8VHRIDVKURXGGXULQJGULOOLQJRSHUDWLRQVLVWHFKQLFDOO\IHDVLEOH %HVW0DQDJHPHQWDQG2SHUDWLRQDO3UDFWLFHVIRU'ULOOLQJDQG%ODVWLQJ %HVWPDQDJHPHQWDQGRSHUDWLRQDOSUDFWLFHVIRUEODVWLQJRSHUDWLRQVLQFOXGHVWKHIROORZLQJXVLQJVXIILFLHQW VWHPOHQJWKDQGUHIUDLQLQJIURPEODVWLQJRSHUDWLRQVGXULQJKLJKZLQGV%HVWPDQDJHPHQWDQGRSHUDWLRQDO SUDFWLFHVIRUGULOOLQJRSHUDWLRQVLQFOXGHVFRQGXFWLQJURXWLQHLQVSHFWLRQVRIGULOOLQJFRQWUROWHFKQRORJLHV7KLV PD\LQFOXGHUHSDLULQJDQGRUUHSODFLQJVKURXGVZKHQWKH\EHFRPHGDPDJHG%HVWPDQDJHPHQWDQG RSHUDWLRQDOSUDFWLFHVIRUFRQWUROOLQJERWKGULOOLQJDQGEODVWLQJRSHUDWLRQVDUHWHFKQLFDOO\IHDVLEOH 'XVW&ROOHFWLRQ6\VWHPRQ'ULOOLQJ(TXLSPHQW 'U\GULOOLQJRSHUDWLRQVDUHFRQWUROOHGZLWKWKHXVHRIDGXVWFROOHFWLRQV\VWHPPRXQWHGQH[WWRWKHGULOO HTXLSPHQW$VKURXGLVXVHGWRSUHYHQWWKHPDMRULW\RIGXVWIURPHVFDSLQJWRWKHDWPRVSKHUH$GXFWURXWHV GXVWIURPWKHVKURXGDUHDWRDILOWHUPHGLXPLQWKHGXVWFROOHFWRU7KHGXVWFROOHFWRUWKHQGXPSVWKH FROOHFWHGGXVWHLWKHUDVDEDWFKRSHUDWLRQRUFRQWLQXRXVO\7KHFRQWUDFWRUWKDW.LOJRUHFRQWUDFWVWRSHUIRUP GULOOLQJRSHUDWLRQVDWWKH%HQMDPLQ3LWXVHVZHWGULOOLQJWHFKQLTXHVUDWKHUWKDQGU\GULOOLQJWHFKQLTXHV$VWKH WZRDUHPXWXDOO\H[FOXVLYHDGXVWFROOHFWLRQV\VWHPLVFRQVLGHUHGWHFKQLFDOO\LQIHDVLEOH :DWHU6SUD\RQ'ULOOLQJ(TXLSPHQW 7KHXVHRIZDWHUVSUD\VRUZHWGULOOLQJRSHUDWLRQVPLWLJDWHVIXJLWLYHGXVWE\ELQGLQJGXVWDQGGLUWSDUWLFOHV WRJHWKHUWKURXJKZDWHU¶VLQKHUHQWSURSHUWLHV:HWGULOOLQJLVDFRPPRQSUDFWLFHLQLQGXVWU\DQGLQYROYHV ZDWHULQMHFWLRQWKURXJKWKHGULOOELWUHPRYLQJGHEULVWKURXJKDVWUHDPRIZDWHU$FFRUGLQJWRWKH1DWLRQDO ,QVWLWXWHIRU2FFXSDWLRQDO6DIHW\DQG+HDOWK1,26+'XVW&RQWURO+DQGERRNIRU,QGXVWULDO0LQHUDOV0LQLQJ DQG3URFHVVLQJ³WKHEHVWPHWKRGIRUGXVWFRQWUROLQVXUIDFHGULOOLQJLVWRXVHZHWGULOOLQJWHFKQLTXHV´:HW GULOOLQJLVFRQVLGHUHGWHFKQLFDOO\IHDVLEOH 'XVW&RQWURO+DQGERRNIRU,QGXVWULDO0LQHUDOV0LQLQJDQG3URFHVVLQJS1,26+0DUFK 7KH2IILFHRI6XUIDFH0LQLQJ86'HSDUWPHQWRI,QWHULRU&RQWUROOLQJWKH$GYHUVH(IIHFWVRI%ODVWLQJ0HWKRGVWR5HGXFH $LUEODVW .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 'ULOOLQJ %ODVWLQJ30DQG306WHS±5DQN5HPDLQLQJ&RQWURO7HFKQRORJLHVE\&RQWURO (IIHFWLYHQHVV 7KHPRVWHIIHFWLYHFRQWUROWHFKQRORJLHVIRUIXJLWLYHGXVWJHQHUDWHGIURPGULOOLQJRSHUDWLRQVDUHSURYLGHGLQ WKHWDEOHEHORZDFFRUGLQJWRHIIHFWLYHQHVV 7DEOH6XPPDU\RI30DQG30&RQWURO0HWKRGVIRU'ULOOLQJ &RQWURO7HFKQRORJLHV5DQN3HUFHQW&RQWURO)HDVLEOH 8VLQJ:DWHU6SUD\ :HW'ULOOLQJ <HV 6KURXG8VH <HV %HVW0DQDJHPHQWDQG 2SHUDWLRQDO3UDFWLFHV 9DULHV <HV 7KHPRVWHIIHFWLYHFRQWUROWHFKQRORJLHVIRUIXJLWLYHGXVWJHQHUDWHGIURPEODVWLQJRSHUDWLRQVDUHSURYLGHGLQ WKHWDEOHEHORZDFFRUGLQJWRHIIHFWLYHQHVV 7DEOH6XPPDU\RI30DQG30&RQWURO7HFKQLTXHVIRU%ODVWLQJ &RQWURO7HFKQRORJLHV5DQN3HUFHQW&RQWURO)HDVLEOH %HVW0DQDJHPHQWDQG 2SHUDWLRQDO3UDFWLFHV 9DULHV <HV 'ULOOLQJ %ODVWLQJ30DQG306WHS±(YDOXDWH0RVW(IIHFWLYH&RQWUROV 'RFXPHQW 5HVXOWV )RUGULOOLQJRSHUDWLRQVQRHQYLURQPHQWDOHFRQRPLFRUHQHUJHWLFGLVFXVVLRQVH[LVWWKDWZRXOGH[HPSWDQ\RI WKHUHPDLQLQJFRQWUROWHFKQRORJLHVOLVWHGLQ7DEOHIURPFRQVLGHUDWLRQ )RUEODVWLQJRSHUDWLRQVJRRGPDQDJHPHQWSUDFWLFHVSURYLGHWKHKLJKHVWUHGXFWLRQLQ30HPLVVLRQV7KHVH SUDFWLFHVLQFOXGHSUHYHQWLQJEODVWLQJRSHUDWLRQVGXULQJKLJKZLQGHYHQWV 'ULOOLQJDQG%ODVWLQJ30DQG306WHS±6HOHFW%$&7 %$&7IRUGULOOLQJRSHUDWLRQVZLOOEHDFFRPSOLVKHGE\XWLOL]LQJZHWGULOOLQJWHFKQLTXHVLQFRQMXQFWLRQZLWKWKH XVHRIDVKURXGDQGEHVWPDQDJHPHQWRSHUDWLRQDOSUDFWLFHV7KHVHSUDFWLFHVLQFOXGHSUHYHQWLQJGULOOLQJ RSHUDWLRQVGXULQJKLJKZLQGHYHQWV,QLWV'XVW&RQWURO+DQGERRNIRU,QGXVWULDO0LQHUDOV0LQLQJDQG 3URFHVVLQJ1,26+VWDWHGWKDW³WKHEHVWPHWKRGIRUGXVWFRQWUROLQVXUIDFHGULOOLQJLVWRXVHZHWGULOOLQJ WHFKQLTXHV´ %$&7IRUEODVWLQJRSHUDWLRQVZLOOEHDFFRPSOLVKHGE\DSSO\LQJEHVWPDQDJHPHQWSUDFWLFHVPLQLPL]LQJWKH EODVWLQJDUHDDQGOLPLWLQJWKHVL]HRIEODVWLQJRSHUDWLRQVWKDWDUHUHODWLYHO\FORVHWRWKHSURSHUW\ERXQGDU\ DQGDYRLGLQJEODVWLQJRSHUDWLRQVGXULQJKLJKZLQGV7KHVHSUDFWLFHVZLOOPLWLJDWHIXJLWLYHGXVWIURPEODVWLQJ RSHUDWLRQV 1,26+'XVW&RQWURO+DQGERRNIRU,QGXVWULDO0LQHUDOV0LQLQJDQG3URFHVVLQJS-DQXDU\ 'XVW&RQWURO+DQGERRNIRU,QGXVWULDO0LQHUDOV0LQLQJDQG3URFHVVLQJS1,26+0DUFK 1,26+'XVW&RQWURO+DQGERRNIRU,QGXVWULDO0LQHUDOV0LQLQJDQG3URFHVVLQJS-DQXDU\ .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 5.4+0$3ODQW 30DQG30±+0$3ODQW .LOJRUHZLOOXVHEDJKRXVHVRQDOOVLORVDVZHOODVRQWKHDVSKDOWGUXPWKHVHDUHQHFHVVDU\DQGVWDQGDUGGXH WRWKHIXJLWLYHQDWXUHRIWKHLUFRQWHQWV)XUWKHUPRUHORDGLQJRIOLPHLQWRLWVVLORLVGRQHSQHXPDWLFDOO\ DQGWKHFRQYH\DQFHRIERWKDVSKDOWDQGOLPHLVGRQHXWLOL]LQJWRWDOHQFORVXUHV$VEDJKRXVHVSURYLGHWKH KLJKHVWFRQWURORIHPLVVLRQVLQDQ+0$SODQWWKHLUXVHLVFRQVLGHUHG%$&7DQGQRIXUWKHU GLVFXVVLRQLVJLYHQ 12;&262DQG92&V±+0$3ODQW 12;&262DQG92&VUHVXOWIURPWKHFRPEXVWLRQRI5)2E\WKHDVSKDOWGUXPDQGWKHKRWRLOKHDWHUDW WKH+0$SODQW7KHVHXQLWVDUHQRWQHZDQGZLOOQRWEHPRGLILHGLQDQ\ZD\WKH\DUHLQFOXGHGKHUHLQRQO\ EHFDXVHWKHLQFUHDVHGWKURXJKSXWRI+0$SURGXFWZLOOUHVXOWLQLQFUHDVHGHPLVVLRQVRIFULWHULDSROOXWDQWV$Q 5%/&VHDUFKRI$VSKDOW&RQFUHWH0DQXIDFWXULQJSHUIRUPHGRQ6HSWHPEHUIRXQGRQO\RQH FRQWUROPHWKRGOLVWHGIRUVLPLODUHTXLSPHQWDW+0$SODQWVJRRGRSHUDWLQJSUDFWLFHV$VJRRGRSHUDWLQJ SUDFWLFHVDUHDOUHDG\LPSOHPHQWHGDWWKH%HQMDPLQ3LWKLVWRULFDOSUHFHGHQWVHWE\WKHDFFHSWDQFHRIWKH FXUUHQW$2VHUYHVDVWKHEDVLVRIWKLV%$&7DQDO\VLV,WLVIRUWKHVHUHDVRQVWKDWWKHIROORZLQJDQDO\VLVLVQRW JLYHQLQ(3$¶VILYHVWHSIRUPDW 7KHEXUQHURQWKHDVSKDOWGUXPLVDORZ12;EXUQHUWKDWPHHWVWKHVSHFLILFDWLRQVJLYHQLQ8$&6HFWLRQ 5,WWKHUHIRUHPHHWV%$&7DVGHILQHGE\WKH6WDWHRI8WDKDQGQRIXUWKHUGLVFXVVLRQLVJLYHQ 'XHWRWKHVPDOOUDWLQJRIWKHKRWRLOKHDWHUOHVVWKDQ00%WXKUFRQWURORSWLRQVDUHQRWWHFKQLFDOO\ IHDVLEOH7KLV%$&7UHYLHZLVFRQVLVWHQWZLWKWKHDQDO\VLVSUHYLRXVO\DFFHSWHGE\8'$4LQ0DUFK (PLVVLRQVRI&2DQG92&VDUHFRQWUROOHGE\WKHXVHRIJRRGFRPEXVWLRQSUDFWLFHV7KHVHDUHDFFRPSOLVKHG WKURXJKIROORZLQJPDQXIDFWXUHUUHFRPPHQGHGSUDFWLFHVLQFOXGLQJWKHIROORZLQJFRPSRQHQWV ჭ3URSHUIXHOPL[LQJLQWKHFRPEXVWLRQ]RQH ჭ+LJKWHPSHUDWXUHVDQGORZR[\JHQOHYHOVLQWKHSULPDU\]RQH ჭ2YHUDOOH[FHVVR[\JHQOHYHOVKLJKHQRXJKWRFRPSOHWHFRPEXVWLRQZKLOHPD[LPL]LQJEXUQHUHIILFLHQF\ DQG ჭ6XIILFLHQWUHVLGHQFHWLPHWRFRPSOHWHFRPEXVWLRQ 7KHVHJRRGFRPEXVWLRQSUDFWLFHVDFFRPSOLVK%$&77KLVLVFRQVLVWHQWZLWKWKH%$&7DQDO\VLVDFFHSWHGE\ 8'$4LQ0DUFK 62HPLVVLRQVDUHPLQLPL]HGE\XVLQJXOWUDORZVXOIXUIXHO5)2ZLOOEHDQDO\]HGIRULWVVXOIXUFRQWHQW .LOJRUHZLOOHQVXUHWKDWWKHVXOIXUFRQWHQWRI5)2LVOHVVWKDQ7KLVLVLQDFFRUGDQFHZLWKWKH%$&7 DQDO\VLVSUHYLRXVO\DFFHSWHGE\8'$4LQ0DUFK 5.5)XHO2LO6WRUDJH7DQNV .LOJRUHXWLOL]HVILYHGLHVHOWDQNVZLWKDWRWDOFDSDFLW\RIJDOORQVDQGRQH5)2WDQNRI JDOORQVDWLWV%HQMDPLQ3LW7KHFRPELQHG37(RI92&VIURPWKHIXHORLOVWRUDJHWDQNVLV(WS\ (3$$36HFWLRQ+RW0L[$VSKDOW3ODQWV ,ELG (3$$LU3ROOXWLRQ&RQWURO7HFKQRORJ\)DFW6KHHWV)DEULF)LOWHUV(3$) .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW $OOWDQNVFDQEHFDWHJRUL]HGDVDERYHJURXQGIL[HGURRIWDQNV7KHVHWDQNVDUHQRWVXEMHFWWRUHJXODWLRQV XQGHU16366XESDUW.E6WDQGDUGVRI3HUIRUPDQFHIRU9RODWLOH/LTXLG6WRUDJH9HVVHOVVLQFHDOOWDQNVPHHW RQHRIWKHWKUHHH[HPSWLRQVWRWKHUHJXODWLRQ Ź$FDSDFLW\RIOHVVWKDQFXELFPHWHUVP Ź$FDSDFLW\RIJUHDWHUWKDQRUHTXDOWRPDQGVWRULQJDOLTXLGZLWKDPD[LPXPWUXHYDSRU SUHVVXUHRIOHVVWKDQNLORSDVFDOVN3DRU Ź$FDSDFLW\RIEHWZHHQPDQGPDQGVWRULQJDOLTXLGZLWKDPD[LPXPWUXHYDSRUSUHVVXUHRI OHVVWKDQN3D )XHO2LO6WRUDJH7DQNV92&V 9RODWLOH+$3V6WHS±,GHQWLI\$OO&RQWURO7HFKQRORJLHV (PLVVLRQVIURPIL[HGURRIVWRUDJHWDQNVUHVXOWIURPGLVSODFHPHQWRIKHDGVSDFHYDSRUGXULQJILOOLQJ RSHUDWLRQVZRUNLQJORVVHVDQGGXULQJGLXUQDOWHPSHUDWXUHDQGKHDWLQJYDULDWLRQVEUHDWKLQJORVVHV%DVHG RQWKHUHYLHZRIWKH5%/&GDWDEDVH%D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW%$$40'&DOLIRUQLD$LU 5HVRXUFHV%RDUG&$5%6DQ-RDTXLQ9DOOH\$LU3ROOXWLRQ&RQWURO'LVWULFW6-9$3&'7H[DV&RPPLVVLRQRQ (QYLURQPHQWDO4XDOLW\7&(4DQGVLPLODURSHUDWLRQV.LOJRUHKDVLGHQWLILHGFRQWUROWHFKQRORJLHVWKDWFRXOG EHDSSOLFDEOHIRUFRQWUROOLQJ92&HPLVVLRQVIURPODUJHDVSKDOWRLOWDQNV5)2WDQNVDQGGLHVHOWDQNV7KH SURSRVHGFRQWUROVDUHDVIROORZV ჭ9DSRU5HFRYHU\6\VWHP ჭ6XEPHUJHG)LOOLQJRI7DQNVDQG ჭ*RRG2SHUDWLQJ3UDFWLFHVDQG0DLQWHQDQFH )XHO2LO6WRUDJH7DQNV92&V 9RODWLOH+$3V6WHS±6HOHFW%$&7 .LOJRUHUHYLHZHGVXEPHUJHGILOOLQJRIGLHVHODQG5)2WDQNVDQGWRDFFRPSOLVKWKLVRSWLRQWKHWDQNVRQVLWH ZRXOGQHHGWREHUHSODFHG%DVHGRQTXRWHVIRUWDQNVRIVLPLODUVSHFLILFDWLRQVDSSUR[LPDWHO\ZRXOG EHUHTXLUHGWRSXUFKDVHHDFKQHZGLHVHOWDQNDQGPRUHIRUWKH5)2WDQN%HFDXVHHDFKWDQNHPLWVOHVV WKDQ(WS\RI92&VLWZDVGHWHUPLQHGWKDWWKHUHSODFHPHQWRIWDQNVZLWKVXEPHUJHGILOOLQJLV HFRQRPLFDOO\LQIHDVLEOHDWWKLVWLPH .LOJRUHUHYLHZHGWKHSRVVLELOLW\RIWKHLQVWDOODWLRQRIDYDSRUUHFRYHU\V\VWHPRQWKHWDQNV9DSRUUHFRYHU\ V\VWHPVW\SLFDOO\FRQWUROKLJKO\YRODWLOHVXEVWDQFHVZLWKKLJK92&ZDVWHVWUHDPV.LOJRUH¶V5)2WDQN FRQWDLQVORZYRODWLOHOLTXLGVDQGHPLWVIHZHU92&VWKDQLVVWDQGDUGIRUYDSRUUHFRYHU\V\VWHPVDQGLW RSHUDWHVDWORZYDSRUSUHVVXUH$YDSRUUHFRYHU\V\VWHPKDVEHHQHOLPLQDWHGIURPIXUWKHUFRQVLGHUDWLRQ EDVHGRQWKLVWHFKQLFDOLQIHDVLELOLW\)XUWKHUPRUHLPSOHPHQWDWLRQFRVWVRIUHTXLUHGIRU YDSRUUHFRYHU\V\VWHPVPDNHWKHWHFKQRORJ\FRVWSURKLELWLYHIRUWKHORZDPRXQWVRI92&VHPLWWHGIURP WKHVHWDQNVDWOHVVWKDQ(WS\HDFKRU(WS\WRWDO 7KHUHIRUH೥WKHSURSRVHG%$&7IRUWKHRQVLWHVWRUDJHWDQNVLVJRRGRSHUDWLQJSUDFWLFHVDQGPDLQWHQDQFH ZLWKQRDGGLWLRQDODGGRQFRQWUROV 5.6$VSKDOW2LO6WRUDJH7DQNV .LOJRUHXWLOL]HVWKUHHDVSKDOWRLOWDQNVRIJDOORQVHDFK7KHFRPELQHG37(RI92&VIURPWKH DVSKDOWRLOVWRUDJHWDQNVLVWS\ 86(3$'RFXPHQWV%HVW3UDFWLFHVIRU9DSRU5HFRYHU\6\VWHPVWR5HGXFH9HQWLQJDQG)ODULQJ 86(3$2]RQH6WDJH7ZR9DSRU5HFRYHU\5XOHDQG*XLGDQFH 86(3$,QVWDOOLQJ9DSRU5HFRYHU\8QLWVRQ6WRUDJH7DQNV2FWREHU .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW $OOWDQNVFDQEHFDWHJRUL]HGDVDERYHJURXQGIL[HGURRIWDQNV7KHVHWDQNVDUHQRWVXEMHFWWRUHJXODWLRQV XQGHU16366XESDUW.E6WDQGDUGVRI3HUIRUPDQFHIRU9RODWLOH/LTXLG6WRUDJH9HVVHOVVLQFHDOOWDQNVPHHW RQHRIWKHWKUHHH[HPSWLRQVWRWKHUHJXODWLRQ Ź$FDSDFLW\RIOHVVWKDQFXELFPHWHUVP Ź$FDSDFLW\RIJUHDWHUWKDQRUHTXDOWRPDQGVWRULQJDOLTXLGZLWKDPD[LPXPWUXHYDSRU SUHVVXUHRIOHVVWKDQNLORSDVFDOVN3DRU Ź$FDSDFLW\RIEHWZHHQPDQGPDQGVWRULQJDOLTXLGZLWKDPD[LPXPWUXHYDSRUSUHVVXUHRI OHVVWKDQN3D $VSKDOW2LO6WRUDJH7DQNV92&V 9RODWLOH+$3V6WHS±,GHQWLI\$OO&RQWURO7HFKQRORJLHV (PLVVLRQVIURPIL[HGURRIDVSKDOWRLOVWRUDJHWDQNVUHVXOWIURPGLVSODFHPHQWRIKHDGVSDFHYDSRUGXULQJ ILOOLQJRSHUDWLRQVZRUNLQJORVVHVDQGZKLOHWKHVWRUHGDVSKDOWRLOLVKHDWHG%DVHGRQWKHUHYLHZRIWKH 5%/&GDWDEDVH%D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW%$$40'&DOLIRUQLD$LU5HVRXUFHV%RDUG &$5%6DQ-RDTXLQ9DOOH\$LU3ROOXWLRQ&RQWURO'LVWULFW6-9$3&'7H[DV&RPPLVVLRQRQ(QYLURQPHQWDO 4XDOLW\7&(4DQGVLPLODURSHUDWLRQV.LOJRUHKDVLGHQWLILHGFRQWUROWHFKQRORJLHVWKDWFRXOGEHDSSOLFDEOH IRUFRQWUROOLQJ92&HPLVVLRQVIURPWKHODUJHDVSKDOWRLOWDQNV7KHSURSRVHGFRQWUROVDUHDVIROORZV ჭ9DSRU5HFRYHU\6\VWHP8QLW958DQG ჭ%HVW0DQDJHPHQW3UDFWLFHV $VSKDOW2LO6WRUDJH7DQNV92&V 9RODWLOH+$3V6WHS(OLPLQDWH7HFKQLFDOO\,QIHDVLEOH 2SWLRQV 9DSRU5HFRYHU\6\VWHP $958RIIHUVFRQWURORIHPLVVLRQVIURPYRODWLOHOLTXLGVWRUDJHWDQNVE\FDSWXULQJDQGFRQYH\LQJSROOXWDQW ODGHQYDSRUVWRDFRQWUROXQLWVXFKDVFDUERQDGVRUSWLRQYDSRUEDODQFHRUUHIULJHUDWHGFRQGHQVHU958V ZHUHQRWIRXQGLQDQ5%/&VHDUFKFRQGXFWHGRQ-DQXDU\DQGZHUHRQO\IRXQGXQGHUWKH&$5% VSHFLILFDOO\ZLWKLQWKH%$$40'DQG6-9$3&'$958LVWHFKQLFDOO\IHDVLEOHIRUWKH%HQMDPLQ3LW¶VDVSKDOWRLO VWRUDJHWDQNV %HVW0DQDJHPHQW3UDFWLFHV %HVWPDQDJHPHQWSUDFWLFHVLQFOXGHUHJXODULQVSHFWLRQVRIWDQNVDQGWKHLUSLSLQJDVZHOODVUHGXFLQJ EUHDWKLQJDQGZRUNLQJORVVHVDVSUDFWLFDO%UHDWKLQJORVVHVFDQEHPLWLJDWHGE\PLQLPL]LQJYDSRUVSDFH ZLWKLQDWDQN7KLVLVGRQHE\RSHUDWLQJWKHWDQNDWDIXOOOHYHODQGDWDFRQVWDQWUDWH7KLVLVFRQVLGHUHG WHFKQLFDOO\IHDVLEOH $VSKDOW2LO6WRUDJH7DQNV92&V 9RODWLOH+$3V6WHS5DQN5HPDLQLQJ&RQWURO7HFKQRORJLHV %RWKWHFKQRORJLHVOLVWHGLQ6WHSDUHFRQVLGHUHGWHFKQLFDOO\IHDVLEOHZLWK958VRIIHULQJWKHKLJKHUFRQWURO HIILFLHQF\WKDQEHVWPDQDJHPHQWSUDFWLFHVYDULDEOH $VSKDOW2LO6WRUDJH7DQNV92&V 9RODWLOH+$3V6WHS(YDOXDWH0RVW(IIHFWLYH&RQWUROV 'RFXPHQW5HVXOWV 7KLVVWHSHYDOXDWHVWKHUHPDLQLQJFRQWUROWHFKQRORJ\IRUHFRQRPLFHQYLURQPHQWDODQGHQHUJHWLFLPSDFWV 7KHSXUFKDVHLQVWDOODWLRQDQGRSHUDWLRQRID958ZDVFRQVLGHUHGIRUWKHDVSKDOWRLOVWRUDJHWDQNVDQG UHVXOWHGLQDFRVWSHUWRQRISROOXWDQWUHPRYHGRI7KLVLVFRQVLGHUHGWREHHFRQRPLFDOO\LQIHDVLEOH $VVXFKD958LVQRWFRQVLGHUHGIRULQVWDOODWLRQDWWKH%HQMDPLQ3LW$SSHQGL[&FRQWDLQVWKHGHWDLOVRIWKLV DQDO\VLV FRQWUROHIILFLHQF\IRU92&VOLVWHGDV%$&7IRUDVSKDOWRLOVWRUDJHWDQNVE\%$$40'DQG6-9$3&'SHUVHDUFK FRQGXFWHGRQ-DQXDU\ .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW $VSKDOW2LO6WRUDJH7DQNV92&V 9RODWLOH+$3V6WHS6HOHFW%$&7 %HVWPDQDJHPHQWSUDFWLFHVDUHWKHRQO\FRQWUROPHWKRGWKDWKDVQRWEHHQGHHPHGLQIHDVLEOHWKURXJK WHFKQLFDOHFRQRPLFHQYLURQPHQWDORUHQHUJHWLFIHDVLELOLW\DQDO\VHV%HVWPDQDJHPHQWSUDFWLFHVLQFOXGH UHJXODULQVSHFWLRQVRIWDQNVDQGWKHLUSLSLQJDVZHOODVUHGXFLQJEUHDWKLQJDQGZRUNLQJORVVHVDVSUDFWLFDO 7KLVLVFRQVLGHUHG%$&7IRUWKHDVSKDOWRLOVWRUDJHWDQNV 5.7'LVWXUEHG*URXQGV )XJLWLYH30DQG30HPLVVLRQVDUHJHQHUDWHGWKURXJKZLQGGLVWXUEDQFHRQH[SRVHGDJJUHJDWH9DULRXV RSHUDWLRQDOSUDFWLFHVFDQEHFRQVLGHUHGIRU%$&77KHPRVWFRPPRQO\SUDFWLFHGRSWLRQLVWRVSUD\ZDWHURQ DOODUHDVQRWFRYHUHGZLWKYHJHWDWLRQRUV\QWKHWLFPDWHULDO7KLVZLOOEHGRQHWKURXJKWKHXVHRIDZDWHU WUXFNRQDFWLYHGLVWXUEHGJURXQGV7KHDJJUHJDWHEHLQJPLQHGDWWKH%HQMDPLQ3LWKDVDKLJKFRQFHQWUDWLRQ RIKDUGURFNUDWKHUWKDQZHDWKHUHGPDWHULDO$VDUHVXOWWKHTXDQWLW\RIILQHVRQWKHPLQHVXUIDFHZLOOEH PLQLPDO :DWHUDSSOLFDWLRQEHVWPDQDJHPHQWSUDFWLFHVDQGPDLQWDLQLQJHVWDEOLVKHGRSDFLW\OLPLWDWLRQVDUH FRQVLGHUHG%$&7WRFRQWUROIXJLWLYHGXVWIURPGLVWXUEHGJURXQGVRQVLWH .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW (0,66,21,03$&7$1$/<6,6 6.1&RPSDULVRQWR0RGHOLQJ7KUHVKROGV 7DEOHFRPSDUHVFULWHULDSROOXWDQWWRWDOSURSRVHGHPLVVLRQVWRDSSOLFDEOHPRGHOLQJWKUHVKROGVFRQWDLQHG LQ5WKURXJKDQG5 7DEOH.LOJRUH(TXLSPHQWDQG2SHUDWLRQV(PLVVLRQVDQG&RPSDULVRQWR0DMRU6RXUFHDQG 0RGHOLQJ7KUHVKROGV 'HVFULSWLRQ3RWHQWLDOWR(PLWWS\ 303012;&26292&&2H &UXVKLQJDQG6FUHHQLQJ2SHUDWLRQV0.23 0.06 0.00 0.00 0.000.00 0.00 6WRFNSLOHVDQG'LVWXUEHG*URXQGV2.07 1.22 0.00 0.00 0.000.00 0.00 %XOOGR]HUVDQG'URSV0.28 0.04 0.00 0.00 0.000.00 0.00 'ULOOLQJDQG%ODVWLQJ0.03 1.54E-03 0.03 0.67 5.92E-050.00 0.00 5RDGV1.92 0.19 0.00 0.00 0.000.00 0.00 7DQNV0.00 0.00 0.00 0.00 0.000.04 6LORV0.02 0.02 0.00 0.06 0.000.34 +RW2LO+HDWHU0.03 0.02 0.55 ( 0.00 181.91 'UXP0L['U\HU 0.46 0.61 2.60 1.160.64 248.67 3URMHFW,QFUHDVH5.04 2.01 1.18 3.38 1.161.03 430.58 0RGHOLQJ/LPLWV 1RQH 1RQH 1RQH 7KUHVKROG([FHHGHG"<HV 1R 1R 1R 1R 1R 1R 0DMRU6RXUFH7KUHVKROGV 7KUHVKROG([FHHGHG"1R 1R 1R 1R 1R 1R 1R .LOJRUH¶V%HQMDPLQ3LWLVORFDWHGLQ8WDK&RXQW\ZKLFKLVLQVHULRXVQRQDWWDLQPHQWIRU309DOXHVDUHSHU8$&5 ELL $PPRQLDDQG+$3VZHUHFRQVLGHUHGLQ.LOJRUH¶V%HQMDPLQ3LW¶VIDFLOLW\ZLGHHPLVVLRQVKRZHYHUWKHVHHPLVVLRQVDUH QRWDSSOLFDEOHDVVLWHSRZHULVSURYLGHGE\OLQHSRZHU 3HU(PLVVLRQV,PSDFW$VVHVVPHQW*XLGHOLQHVSXEOLVKHGE\8'$4 9DOXHVDUHSHU8$&5ELL 7KHDLUGLVSHUVLRQPRGHOLQJDQDO\VHVZLOOEHSHUIRUPHGWRGHPRQVWUDWHWKDWWKHLPSDFWVRIWKHVLWHZLGH 30DQG12HPLVVLRQVIURP.LOJRUH¶V%HQMDPLQ3LWZLOOQRWH[FHHGWKH1$$46$OWKRXJK12GLGQRW H[FHHGWKHPRGHOLQJWKUHVKROGDQDQDO\VLVRIWKHKRXUO\DQGDQQXDOVWDQGDUGZLOOEHSURYLGHG ,IWKLVRSHUDWLQJVFHQDULRZRXOGFKDQJHLQWKHIXWXUH.LOJRUHZLOOQRWLI\8'$4GD\VSULRUWRWKHFKDQJH RUVXEPLWDUHYLVHG12,DLUSHUPLWDSSOLFDWLRQ %HFDXVHWKHWRWDOHPLVVLRQLQFUHDVHVDW.LOJRUH¶V%HQMDPLQ3LWGRQRWFRQVWLWXWHDPDMRUVRXUFHDYLVLELOLW\ DQDO\VLVLVQRWUHTXLUHG 5 .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 121$77$,10(170$,17(1$1&($5($62))6(77,1* 3HU8'$4¶V)RUPIRU12,DQG5DQG5WKLVVHFWLRQVKRXOGLQFOXGHRIIVHWUHTXLUHPHQWVIRU QRQDWWDLQPHQWDQGPDLQWHQDQFHDUHDV.LOJRUH¶V%HQMDPLQ3LWLVORFDWHGZLWKLQD30QRQDWWDLQPHQWDUHD 7.12IIVHW$SSOLFDELOLW\ 302IIVHWV 30RIIVHWVDUHDSSOLFDEOHWRPDMRUVRXUFHVORFDWHGZLWKLQRULPSDFWLQJD30QRQDWWDLQPHQWDUHDRIWKH 1$$46$PDMRUVRXUFHLQDVHULRXVQRQDWWDLQPHQWDUHDLVGHILQHGLQ5EDV³DQ\VWDWLRQDU\ VRXUFHRIDLUSROOXWDQWVZKLFKHPLWVRUKDVWKH>37(@>73<@RUPRUHRIGLUHFW30RUDQ\LQGLYLGXDO30 SUHFXUVRUDVGHILQHGLQ5F>LH6212;92&VDQGDPPRQLD@´.LOJRUH¶V%HQMDPLQ3LWLV QRWDPDMRUVRXUFHDQGLWLVWKHUHIRUHQRWVXEMHFWWRWKHRIIVHWUHTXLUHPHQWVRI5 302IIVHWV 30RIIVHWVUHTXLUHPHQWVDUHGHVFULEHGLQ8$&57KH\DSSO\WRQHZRUPRGLILHGVRXUFHVRI62 RU12;WKDWDUHORFDWHGLQRULPSDFW6DOW/DNH&RXQW\RU8WDK&RXQW\.LOJRUH¶V%HQMDPLQ3LWLVORFDWHGLQ 8WDK&RXQW\EXWLVQRWLQFUHDVLQJLWV3012;DQG62HPLVVLRQVE\PRUHWKDQWS\DJJUHJDWHG .LOJRUH¶V%HQMDPLQ3LWLVWKHUHIRUHQRWVXEMHFWWRWKH30RIIVHWUHTXLUHPHQWVRI5 2]RQH2IIVHWV 2]RQHRIIVHWVUHTXLUHPHQWVUHFRUGHGLQ8$&5DQG92&RIIVHWVDUHDSSOLFDEOHWRVLJQLILFDQW VRXUFHVORFDWHGZLWKLQRULPSDFWLQJDQR]RQHQRQDWWDLQPHQWDUHDRIWKH1$$46,QVXPPDU\VLJQLILFDQW VRXUFHVORFDWHGLQ'DYLV&RXQW\RU6DOW/DNH&RXQW\VKDOORIIVHWWKHSURSRVHGLQFUHDVHLQ92&HPLVVLRQVE\ DUDWLRRIEHIRUHWKH'LUHFWRUPD\LVVXHDQ$2WRFRQVWUXFWPRGLI\RUUHORFDWHXQGHU5$V .LOJRUH¶V%HQMDPLQ3LWLVORFDWHGLQ8WDK&RXQW\R]RQHRIIVHWVDUHQRWDSSOLFDEOH )XUWKHUPRUHVLJQLILFDQWPHDQVIRUWKHSXUSRVHVRIGHWHUPLQLQJZKDWLVDVLJQLILFDQWHPLVVLRQLQFUHDVHRUD VLJQLILFDQWQHWHPLVVLRQLQFUHDVHDQGWKHUHIRUHDPDMRUPRGLILFDWLRQDUDWHRIHPLVVLRQVWKDWZRXOGHTXDORU H[FHHGDQ\RIWKHIROORZLQJUDWHV IRUYRODWLOHRUJDQLFFRPSRXQGVWRQVSHU\HDU IRUQLWURJHQR[LGHVWRQVSHU\HDU 7KH37(RI.LOJRUH¶V%HQMDPLQ3LWSUHVHQWHGLQ$SSHQGL[%LVOHVVWKDQWS\RI92&VVROLGLI\LQJWKH LQDSSOLFDELOLW\RIR]RQHRIIVHWVHVWDEOLVKHGLQ5 .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW $33/,&$%/(5(*8/$7,216 8.1*HQHUDO,QWURGXFWLRQ±8WDK5HJXODWLRQV .LOJRUHKDVHYDOXDWHGWKHDSSOLFDELOLW\RIHDFKUXOHXQGHUWKH8$&7LWOH55XOHVWKDWDUHJHQHUDOO\ DSSOLFDEOHWR.LOJRUH¶V%HQMDPLQ3LWEXWQRWDVVRFLDWHGZLWKRQHVSHFLILFSURSRVHGFKDQJHZLOOQRWEH GLVFXVVHGLQWKLVVHFWLRQ$OORWKHUDSSOLFDEOHUXOHVDVVRFLDWHGZLWKWKHSURMHFWGHVFULEHGLQWKLV12,DLU SHUPLWDSSOLFDWLRQZLOOEHGLVFXVVHGLQWKHVXEVHTXHQWVXEVHFWLRQV 7DEOH(YDOXDWLRQRI8'$4$LU4XDOLW\5XOHV 5HIHUHQFH5HJXODWLRQ1DPH$SSOLFDELOLW\ <HV1R 5 *HQHUDO5HTXLUHPHQWV ; 5 *HQHUDO5HTXLUHPHQWV%URDGO\$SSOLFDEOH 5HTXLUHPHQWV; 5$GPLQLVWUDWLYH3URFHGXUHV ; 5 &RQIOLFWRI,QWHUHVW ; 5*HQHUDO5HTXLUHPHQWV(PHUJHQF\FRQWUROV ; 5 *HQHUDO5HTXLUHPHQWV%UHDNGRZQV ; 5 *HQHUDO5HTXLUHPHQWV6WDWH,PSOHPHQWDWLRQ 3ODQ; 5*HQHUDO&RQIRUPLW\ ; 5 *HQHUDO5HTXLUHPHQWV7D[([HPSWLRQIRU$LU 3ROOXWLRQ&RQWURO(TXLSPHQW; 5 *HQHUDO5HTXLUHPHQWV&OHDQ$LUDQG(IILFLHQW 9HKLFOH7D[&UHGLW ; 5 *HQHUDO5HTXLUHPHQWV+HDY\'XW\9HKLFOH7D[ &UHGLW ; 5 *HQHUDO5HTXLUHPHQWV&OHDQ)XHOVDQG9HKLFOH 7HFKQRORJ\*UDQWDQG/RDQ3URJUDP ; 5 *HQHUDO5HTXLUHPHQWV&RQYHUVLRQWR$OWHUQDWLYH )XHO*UDQW3URJUDP ; 5 &OHDQ$LU5HWURILW5HSODFHPHQWDQG2II5RDG 7HFKQRORJ\3URJUDP ; 5*HQHUDO3HQDOW\3ROLF\ ; 5 (QIRUFHPHQW3ROLF\IRU$VEHVWRV+D]DUG (PHUJHQF\5HVSRQVH$FW ; 5(PLVVLRQ,QYHQWRULHV ; 5 (PLVVLRQ7HVWLQJ ; 5&RQWLQXRXV(PLVVLRQ0RQLWRULQJ3URJUDP ; 5(PLVVLRQ6WDQGDUGV*HQHUDO(PLVVLRQ6WDQGDUGV ; .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 5HIHUHQFH5HJXODWLRQ1DPH$SSOLFDELOLW\ <HV1R 5(PLVVLRQ6WDQGDUGV*HQHUDO%XUQLQJ ; 5(PLVVLRQ6WDQGDUGV6XOIXU&RQWHQWRI)XHOV ; 5(PLVVLRQ6WDQGDUGV6PRNH0DQDJHPHQW ; 5 (PLVVLRQ6WDQGDUGV)XJLWLYH(PLVVLRQVDQG )XJLWLYH'XVW; 5 (PLVVLRQ6WDQGDUGV$EUDVLYH%ODVWLQJ; 5 5HVLGHQWLDO)LUHSODFHVDQG6ROLG)XHO%XUQLQJ 'HYLFHV ; 52XWGRRU:RRG%RLOHUV ; 5 6WDQGDUGVRI3HUIRUPDQFHIRU1HZ6WDWLRQDU\ 6RXUFHV; 5 1DWLRQDO(PLVVLRQ6WDQGDUGVIRU+D]DUGRXV$LU 3ROOXWDQWV; 5 (PLVVLRQ6WDQGDUGV3ODQIRU'HVLJQDWHG )DFLOLWLHV ; 5 (PLVVLRQ6WDQGDUGV(PLVVLRQ&RQWUROVIRU ([LVWLQJ0XQLFLSDO6ROLG:DVWH/DQGILOOV ; 5 (PLVVLRQ6WDQGDUGV([LVWLQJ,QFLQHUDWRUIRU +RVSLWDO0HGLFDO,QIHFWLRXV:DVWH ; 5 (PLVVLRQ6WDQGDUGV([LVWLQJ6PDOO0XQLFLSDO :DVWH&RPEXVWLRQ8QLWV ; 5 0HUFXU\(PLVVLRQ6WDQGDUGV&RDO)LUHG(OHFWULF *HQHUDWLQJ8QLWV ; 512;(PLVVLRQ/LPLWVIRU1DWXUDO*DV)LUHG:DWHU +HDWHUV ; 5 :HVWHUQ%DFNVWRS6XOIXU'LR[LGH7UDGLQJ 3URJUDP ; 5 8WDKDQG:HEHU&RXQWLHV2[\JHQDWHG*DVROLQH 3URJUDPDVD&RQWLQJHQF\0HDVXUH ; 56ROLG)XHO%XUQLQJ'HYLFHV ; 5&RPPHUFLDO&RRNLQJ ; 5 6ROYHQW&OHDQLQJ ; 5 1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDVIRU30 (PLVVLRQ6WDQGDUGV; 5 301RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV $EUDVLYH%ODVWLQJ; 5 5RDG6DOWLQJDQG6DQGLQJ ; .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 5HIHUHQFH5HJXODWLRQ1DPH$SSOLFDELOLW\ <HV1R 5 1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDVIRU30 DQG30)XJLWLYH(PLVVLRQVDQG)XJLWLYH'XVW; 5 6DOW/DNH&RXQW\7UDGLQJRI(PLVVLRQ%XGJHWV IRU7UDQVSRUWDWLRQ&RQIRUPLW\ ; 5 8WDK&RXQW\7UDGLQJRI(PLVVLRQ%XGJHWVIRU 7UDQVSRUWDWLRQ&RQIRUPLW\ ; 5 $JJUHJDWH3URFHVVLQJ2SHUDWLRQVIRU30 1RQDWWDLQPHQW$UHDV; 5 2]RQH0DLQWHQDQFH$UHDVDQG2JGHQ&LW\ (PSOR\HU%DVHG7ULS5HGXFWLRQ; 52]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV *HQHUDO5HTXLUHPHQWV; 5 2]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV &RQWURORI+\GURFDUERQ(PLVVLRQVLQ3HWUROHXP 5HILQHULHV ; 5 2]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV 3HWUROHXP/LTXLG6WRUDJH ; 5 *DVROLQH7UDQVIHUDQG6WRUDJH ; 5 'HJUHDVLQJ ; 52]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV &XWEDFN$VSKDOW; 5 $GKHVLYHVDQG6HDODQWV ; 5:RRG)XUQLWXUH0DQXIDFWXULQJ2SHUDWLRQV ; 53DSHU)LOPDQG)RLO&RDWLQJV ; 5)DEULFDQG9LQ\O&RDWLQJV ; 50HWDO)XUQLWXUH6XUIDFH&RDWLQJV ; 5/DUJH$SSOLFDEOH6XUIDFH&RDWLQJV ; 50DJQHW:LUH&RDWLQJV ; 5)ODW:RRG3DQHO&RDWLQJ ; 50LVF0HWDO3DUWVDQG3URGXFW&RDWLQJ ; 5 *UDSKLF$UWV ; 50HWDO&RQWDLQHU&ORVXUHDQG&RLO&RDWLQJV ; 53ODVWLF3DUWV&RDWLQJV ; 5$XWRPRWLYH5HILQLVKLQJ&RDWLQJV ; .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 5HIHUHQFH5HJXODWLRQ1DPH$SSOLFDELOLW\ <HV1R 5$HURVSDFH0DQXIDFWXUHDQG5HZRUN)DFLOLWLHV ; 5$SSOLDQFH3LORW/LJKW ; 5&RQVXPHU3URGXFWV ; 5 $UFKLWHFWXUDO&RDWLQJV; 5 3HUPLW1HZDQG0RGLILHG6RXUFHV ; 5 3HUPLWV1HZDQG0RGLILHG6RXUFHVLQ 1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV ; 5 3HUPLWV0DMRU6RXUFHVLQ$WWDLQPHQWRU 8QFODVVLILHG$UHDV36' ; 5 9LVLELOLW\ ; 5 3HUPLWV(PLVVLRQ,PSDFW$QDO\VLV ; 5 3HUPLWV)HHVIRU$SSURYDO2UGHUV ; 5 3HUPLWV2SHUDWLQJ3HUPLW5HTXLUHPHQWV; 5 3HUPLWV$FLG5DLQ6RXUFHV ; 53HUPLWV2]RQH2IIVHW5HTXLUHPHQWVLQ6DOW/DNH &RXQW\DQG'DYLV&RXQW\; 53HUPLWV302IIVHW5HTXLUHPHQWVLQ6DOW/DNH &RXQW\DQG8WDK&RXQW\; 5 3HUPLWV0HUFXU\5HTXLUHPHQWVIRU(OHFWULF *HQHUDWLQJ8QLWV ; 5WR 2LODQG*DV,QGXVWU\ ; 5 8WDK$VEHVWRV5XOH; 5 /HDG%DVHG3DLQW3URJUDP3XUSRVH$SSOLFDELOLW\ DQG'HILQLWLRQV; 5 5HVLGHQWLDO3URSHUW\DQG&KLOG2FFXSLHG)DFLOLW\ 5HQRYDWLRQ ; 5 /HDG%DVHG3DLQW$FWLYLWLHV ; 7KHVXEMHFWUXOHLVDSSOLFDEOHWR.LOJRUH¶V%HQMDPLQ3LWKRZHYHUWKLVUXOHLVQRWVSHFLILFWRRSHUDWLRQDO FRPSOLDQFHUHTXLUHPHQWVDQGLVWKHUHIRUHQRWGLVFXVVHGLQWKLV12,DLUSHUPLWDSSOLFDWLRQ $SSOLFDEOH1636DQG1(6+$3UHJXODWLRQVDUHGHWDLOHGXQGHUDSSURSULDWHIHGHUDOUXOHKHDGLQJV 8$&5*HQHUDO5HTXLUHPHQWV .LOJRUH¶V%HQMDPLQ3LWZLOOFRPSO\DQGFRQIRUPWRWKHGHILQLWLRQVWHUPVDEEUHYLDWLRQVDQG UHIHUHQFHVXVHGLQWKH8$&5DQG&)5 8$&5*HQHUDO5HTXLUHPHQWV%UHDNGRZQV .LOJRUH¶V%HQMDPLQ3LWZLOOUHSRUWEUHDNGRZQVZLWKLQKRXUVYLDWHOHSKRQHHOHFWURQLFPDLOID[RU RWKHUVLPLODUPHWKRGDQGSURYLGHGHWDLOHGZULWWHQGHVFULSWLRQZLWKLQGD\VRIWKHRQVHWRIWKH LQFLGHQWWR8'$4 .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 8$&5(PLVVLRQ,QYHQWRULHV )RUHYHU\WKLUG\HDU.LOJRUH¶V%HQMDPLQ3LWZLOOUHSRUWLWVHPLVVLRQVLQYHQWRU\LQDFFRUGDQFHZLWK 57KHHPLVVLRQVLQYHQWRU\VKDOOLQFOXGHDOOFULWHULDSROOXWDQWVLQFOXGLQJILOWHUDEOHDQG FRQGHQVDEOH30KD]DUGRXVDLUSROOXWDQWVQRWH[HPSWHGLQ5DQGFKDUJHDEOHSROOXWDQWVLQ DFFRUGDQFHZLWK5 8$&5(PLVVLRQ7HVWLQJ .LOJRUH¶V%HQMDPLQ3LWZLOOFRQGXFWVWDFNWHVWLQJDWOHDVWRQFHHYHU\ILYH\HDUVDQGDVUHTXLUHG E\6HFWLRQ,,%RILWV$SSURYDO2UGHU6WDFNWHVWLQJZLOOEHFRQGXFWHGLQDFFRUGDQFHZLWK5 5HSRUWLQJDQGUHFRUGNHHSLQJUHTXLUHPHQWVZLOOEHPHW 8$&5(PLVVLRQ6WDQGDUGV*HQHUDO(PLVVLRQ6WDQGDUGV $OOUXOHVDSSOLFDEOHWR.LOJRUH¶V%HQMDPLQ3LWDUHLQFRUSRUDWHGE\UHIHUHQFHIURP&)53DUW $SSOLFDELOLW\DQGUHTXLUHPHQWVIRUWKHVHUXOHVDUHRXWOLQHGLQ6HFWLRQRIWKLVVXEPLWWDO 8$&5(PLVVLRQ6WDQGDUGV6XOIXU&RQWHQWRI)XHOV .LOJRUH¶V%HQMDPLQ3LWXWLOL]HVIXHORLOWRSRZHULWV+0$GU\HUDQGLWVKRWRLOKHDWHU5HFRUGNHHSLQJ DQGUHSRUWLQJUHJXODWLRQVLQWKLVUXOHZLOOEHPHW6XOIXUFRQWHQWRIIXHORLOXVHGIRUHLWKHUSLHFHRI PHQWLRQHGHTXLSPHQWZLOOKDYHDVXOIXUFRQWHQWOHVVWKDQSRXQGVSHUPLOOLRQJURVV%78KHDW LQSXW 8$&5(PLVVLRQ6WDQGDUGV)XJLWLYH(PLVVLRQVDQG)XJLWLYH'XVW 8$&5(PLVVLRQ6WDQGDUGV±)XJLWLYH(PLVVLRQV .LOJRUH¶V%HQMDPLQ3LWLVORFDWHGLQ8WDK&RXQW\ZKLFKLVDQRQDWWDLQPHQWDUHDIRU30)XJLWLYH HPLVVLRQVIURPVRXUFHVVKDOOQRWH[FHHGRSDFLW\ 8$&5(PLVVLRQ6WDQGDUGV)XJLWLYH'XVW 2ZQLQJRSHUDWLQJRUPDLQWDLQLQJDQHZRUH[LVWLQJPDWHULDOVWRUDJHKDQGOLQJRUKDXOLQJRSHUDWLRQ VKDOOWDNHPHDVXUHVWRPLQLPL]HIXJLWLYHGXVWIURPVXFKDFWLYLWLHV6XFKFRQWUROPD\LQFOXGHHQFORVXUHV FRYHUVVWDELOL]DWLRQRURWKHUHTXLYDOHQWPHWKRGVRUWHFKQLTXHVDVDSSURYHGE\WKHGLUHFWRU .LOJRUH¶V%HQMDPLQ3LWZLOOFRPSO\ZLWKPLQLPL]DWLRQWHFKQLTXHVDVGHVFULEHGLQ56WHSVZLOOEH WDNHQWRPLQLPL]HIXJLWLYHGXVWV 8$&5(PLVVLRQ6WDQGDUGV±5RDGV .LOJRUH¶V%HQMDPLQ3LWZLOOVXSSO\WUDIILFFRXQWLQIRUPDWLRQDVGHWHUPLQHGQHFHVVDU\DQGFOHDQDQ\ GHSRVLWHGPDWHULDOVWKDWPD\FUHDWHIXJLWLYHGXVW 8$&5(PLVVLRQ6WDQGDUGV±0LQLQJ$FWLYLWLHV 0LQLPL]LQJIXJLWLYHGXVWVKDOOEHDQLQWHJUDOSDUWRIVLWHSUHSDUDWLRQPLQLQJDFWLYLWLHVDQGUHFODPDWLRQ RSHUDWLRQV)XJLWLYHGXVWFRQWUROPHDVXUHVLQFOXGHSHULRGLFZDWHULQJRIXQSDYHGURDGVDQGDSSOLFDWLRQ RIFKHPLFDOVXSSUHVVDQWWRXQSDYHGURDGVDQGSURPSWUHPRYDORIFRDOURFNPLQHUDOVVRLODQGRWKHU GXVWIRUPLQJGHEULVIURPURDGV$GGLWLRQDOFRQWUROVLQFOXGHIUHTXHQWVFUDSLQJDQGFRPSDFWLRQRI XQSDYHGURDGVWRVWDELOL]HWKHURDGVXUIDFHUHVWULFWLQJWKHVSHHGRIYHKLFOHVLQDQGDURXQGWKHPLQLQJ RSHUDWLRQDQGUHVWULFWLQJWKHWUDYHORIYHKLFOHVRQRWKHUWKDQHVWDEOLVKHGURDGV(QFORVLQJFRYHULQJ ZDWHULQJRURWKHUZLVHWUHDWLQJORDGHGKDXOWUXFNVWRPLQLPL]HORVVRIPDWHULDOWRZLQGDQGVSLOODJHLVD .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW YLDEOHPHDQVWRFRQWUROIXJLWLYHGXVWIURPKDXOWUXFNV6XEVWLWXWLRQRIFRQYH\RUV\VWHPVIRUKDXOWUXFNV DQGWKHFRYHULQJRIFRQYH\RUV\VWHPVDUHVXEMHFWWRZLQGHURVLRQ$GGLWLRQDOO\PLQLPL]LQJWKHGLVWXUEHG JURXQGVDQGHQJDJLQJLQDFWLYLWLHVVXFKDVUHYHJHWDWLRQPXOFKLQJRURWKHUZLVHVWDELOL]LQJWKHVXUIDFHRI DOODUHDVDGMRLQLQJURDGVWKDWDUHVRXUFHRIIXJLWLYHGXVW .LOJRUH¶V%HQMDPLQ3LWZLOOFRPSO\ZLWKPLQLPL]DWLRQWHFKQLTXHVGHVFULEHGLQ5.LOJRUH¶V %HQMDPLQ3LWZLOODOVRHQJDJHLQYDULRXVWHFKQLTXHVDLPHGWRUHGXFHIXJLWLYHGXVWIURPPLQLQJDFWLYLWLHV 7HFKQLTXHVLQFOXGHEXWDUHQRWOLPLWHGWRZDWHUFRQWUROVPDLQWDLQLQJERWKSDYHGDQGXQSDYHGURDGV UHVWULFWLQJWKHVSHHGRIYHKLFOHVLQDQGDURXQGPLQLQJRSHUDWLRQVDQGFRQWURORIGXVWIURPVWRUDJHSLOHV 8$&51RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDVIRU30DQG30)XJLWLYH (PLVVLRQVDQG)XJLWLYH'XVW )XJLWLYHHPLVVLRQVIURPDQ\VRXUFHVVKDOOQRWH[FHHGRSDFLW\ )XJLWLYHGXVWVKDOOQRWH[FHHGWKHIROORZLQJRSDFLW\OLPLWV DDWWKHSURSHUW\ERXQGDU\DQG ERQVLWH $Q\SHUVRQUHVSRQVLEOHIRUFRQVWUXFWLRQRUPDLQWHQDQFHRIDQ\H[LVWLQJURDGRUKDYLQJULJKWRIZD\ HDVHPHQWRUSRVVHVVLQJWKHULJKWWRXVHWKHVDPHZKRVHDFWLYLWLHVUHVXOWLQIXJLWLYHGXVWIURPWKHURDG VKDOOPLQLPL]HIXJLWLYHGXVWWRWKHPD[LPXPH[WHQWSRVVLEOH$Q\VXFKSHUVRQZKRGHSRVLWVPDWHULDOV WKDWPD\FUHDWHIXJLWLYHGXVWRQDSXEOLFRUSULYDWHSDYHGURDGVKDOOFOHDQWKHURDGSURPSWO\ .LOJRUH¶V%HQMDPLQ3LWZLOOPLQLPL]HIXJLWLYHGXVWFUHDWHGIURPWKHFRQVWUXFWLRQDQGPDLQWHQDQFHRIWKH H[LVWLQJSDYHGURDGWRWKHH[WHQWERWKSUDFWLFDODQGSRVVLEOH 8$&5$JJUHJDWH3URFHVVLQJ2SHUDWLRQVIRU301RQDWWDLQPHQW$UHDV 59LVLEOH(PLVVLRQV 9LVLEOHHPLVVLRQVIURPDJJUHJDWHSURFHVVLQJRSHUDWLRQVVKDOOQRWH[FHHGRSDFLW\OLPLWVDVGHVFULEHGLQ $SSHQGL[7DEOH, 7DEOH$JJUHJDWH3URFHVVLQJ2SHUDWLRQV9LVLEOH(PLVVLRQV &DWHJRU\2SDFLW\/LPLW &UXVKHUV 6FUHHQV &RQYH\RU7UDQVIHU3RLQWV .LOJRUH¶V%HQMDPLQ3LWZLOOFRPSO\ZLWKYLVLEOHHPLVVLRQVIRUDJJUHJDWHSURFHVVLQJRSHUDWLRQVGHVFULEHG LQ5 8$&52]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV*HQHUDO5HTXLUHPHQWV .LOJRUHZLOOFRQWLQXHWRFRPSO\ZLWKJHQHUDOUHTXLUHPHQWVIRUWKHFRQWURORI92&V.LOJRUHZLOOQRWDOORZRU FDXVH92&VWREHVSLOOHGGLVFDUGHGRUVWRUHGLQRSHQFRQWDLQHUV 8$&5$SSURYDO2UGHU 7KHGLUHFWRUZLOOLVVXHDQ$2LIDOOFRQGLWLRQVDQGUHJXODWLRQVKDYHEHHQPHW D7KHGHJUHHRISROOXWLRQFRQWUROIRUHPLVVLRQVWRLQFOXGHIXJLWLYHHPLVVLRQVDQGIXJLWLYHGXVWLVDW OHDVWEHVWDYDLODEOHFRQWUROWHFKQRORJ\:KHQGHWHUPLQLQJEHVWDYDLODEOHFRQWUROWHFKQRORJ\IRUD .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW QHZRUPRGLILHGVRXUFHLQDQR]RQHQRQDWWDLQPHQWRUPDLQWHQDQFHDUHDWKDWZLOOHPLW92&RU12; EHVWDYDLODEOHFRQWUROWHFKQRORJ\VKDOOEHDWOHDVWDVVWULQJHQWDVDQ\&RQWURO7HFKQLTXH*XLGDQFH GRFXPHQWWKDWKDVEHHQSXEOLVKHGE\(3$WKDWLVDSSOLFDEOHWRWKHVRXUFH E7KH%HQMDPLQ3LWZLOOPHHWWKHDSSOLFDEOHUHTXLUHPHQWVRI L53HUPLWV1HZDQG0RGLILHG6RXUFHVLQ1RQDWWDLQPHQW$UHDVDQG0DLQWHQDQFH $UHDV LL53HUPLWV0DMRU6RXUFHVLQ$WWDLQPHQWRU8QFODVVLILHG$UHDV36' LLL59LVLELOLW\ LY5(PLVVLRQV,PSDFW$QDO\VLV Y53HUPLWV2]RQH2IIVHW5HTXLUHPHQWVLQ'DYLVDQG6DOW/DNH&RXQWLHV YL51DWLRQDO6WDQGDUGVRI3HUIRUPDQFHIRU1HZ6WDWLRQDU\6RXUFHV YLL1DWLRQDO3ULPDU\DQG6HFRQGDU\$PELHQW$LU4XDOLW\6WDQGDUGV YLLL51DWLRQDO(PLVVLRQ6WDQGDUGVIRU+D]DUGRXV$LU3ROOXWDQWV L[58WDK6WDWH,PSOHPHQWDWLRQ3ODQDQG [$OORWKHUSURYLVLRQVRI5 7KH$2UHTXLUHVWKDWDOOSROOXWLRQFRQWUROHTXLSPHQWEHDGHTXDWHO\DQGSURSHUO\PDLQWDLQHG 5HFHLSWRIDQ$2GRHVQRWUHOLHYHDQ\RZQHURURSHUDWRURIWKHUHVSRQVLELOLW\WRFRPSO\ZLWKWKH SURYLVLRQVRI5RUWKH6WDWH,PSOHPHQWDWLRQ3ODQ .LOJRUH¶V%HQMDPLQ3LWZLOOHVWDEOLVKDQGPDLQWDLQFRPSOLDQFHWKURXJKWKHIROORZLQJ $OOSROOXWLRQFRQWUROHTXLSPHQWZLOOEHSURSHUO\PDLQWDLQHGDQG 3URYLVLRQVRI5RU6,3ZLOOEHIROORZHG %$&7SURYLVLRQVVSHFLILHGLQ8$&5KDYHEHHQDSSOLHGWKURXJKFRQWUROHTXLSPHQWLQVWDOOHGDQG PRQLWRULQJFRQGLWLRQV 8$&53HUPLWV(PLVVLRQ,PSDFW$QDO\VLV (PLVVLRQLPSDFWVDVVRFLDWHGZLWK.LOJRUH¶V%HQMDPLQ3LWDUHDGGUHVVHGLQ6HFWLRQRIWKLVVXEPLWWDO 8$&53HUPLWV)HHVIRU$SSURYDO2UGHUV )HHVDVVRFLDWHGZLWKWKHVXEPLVVLRQRIWKLV12,DUHDGGUHVVHGLQ6HFWLRQRIWKLVVXEPLWWDO 8.2)HGHUDO5HJXODWLRQV 16366XESDUW$*HQHUDO3URYLVLRQV $OODIIHFWHGVRXUFHVVXEMHFWWRDQ1636DUHDOVRVXEMHFWWRWKHJHQHUDOSURYLVLRQVRI16366XESDUW$XQOHVV VSHFLILFDOO\H[FOXGHGE\WKHVRXUFHVSHFLILF163616366XESDUW$UHTXLUHVWKHIROORZLQJRIIDFLOLWLHVVXEMHFW WRDVRXUFHVSHFLILF1636 Ź,QLWLDOFRQVWUXFWLRQUHFRQVWUXFWLRQQRWLILFDWLRQ Ź,QLWLDOVWDUWXSQRWLILFDWLRQ Ź3HUIRUPDQFHWHVWV Ź3HUIRUPDQFHWHVWGDWHLQLWLDOQRWLILFDWLRQ Ź*HQHUDOPRQLWRULQJUHTXLUHPHQWV .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW Ź*HQHUDOUHFRUGNHHSLQJUHTXLUHPHQWV Ź6HPLDQQXDOPRQLWRULQJV\VWHPDQGRUH[FHVVHPLVVLRQUHSRUWV 16366XESDUW,6WDQGDUGVRI3HUIRUPDQFHIRU+RW0L[$VSKDOW)DFLOLWLHV 16366XESDUW,6WDQGDUGVRI3HUIRUPDQFHIRU+RW0L[$VSKDOW)DFLOLWLHVSURYLGHVWDQGDUGVRISHUIRUPDQFH IRU+0$IDFLOLWLHVWKDWDUHFRQVWUXFWHGRUPRGLILHGDIWHU-XQH7KH%HQMDPLQ)DFLOLW\KDVWKH IROORZLQJDIIHFWHGIDFLOLWLHVXQGHU16366XESDUW, ჭ'U\HU ჭ6\VWHPVIRUVFUHHQLQJKDQGOLQJVWRULQJDQGZHLJKLQJKRWDJJUHJDWH ჭ6\VWHPVIRUPL[LQJ+0$DQG ჭ6\VWHPVIRUORDGLQJWUDQVIHUDQGVWRUDJHV\VWHPVDVVRFLDWHGZLWKVWRUDJHFRQWUROV\VWHPV 7KHDIIHFWHGIDFLOLW\PXVWPHHWVWDQGDUGVIRUSDUWLFXODWHPDWWHURXWOLQHGLQ7DEOH,EHORZRQDQGDIWHUWKH GDWHWKHSHUIRUPDQFHWHVWLVFRPSOHWHGDVUHTXLUHGE\&)5 7DEOH1636,6WDQGDUGIRU3DUWLFXODWH0DWWHU 6WDQGDUGIRU3DUWLFXODWH0DWWHU5HJXODWRU\ &LWDWLRQ 30PJGVFPJUGVFI D 2SDFLW\ D 7HVWPHWKRGVDQGSURFHGXUHVWRGHWHUPLQHFRPSOLDQFHZLWKSDUWLFXODWHPDWWHUVWDQGDUGVGHVFULEHGDERYH VKDOOEHFRQGXFWHGDVIROORZV ჭ0HWKRG±30&RQFHQWUDWLRQV ჭ0HWKRG±2SDFLW\ .LOJRUHZLOOGHPRQVWUDWHFRPSOLDQFHZLWKWKHUHTXLUHPHQWVXSRQFRPSOHWLRQRIFRQVWUXFWLRQRIWKHDIIHFWHG %HQMDPLQ)DFLOLW\ 16366XESDUW.E6WDQGDUGVRI3HUIRUPDQFHIRU9RODWLOH2UJDQLF/LTXLG6WRUDJH9HVVHOV ,QFOXGLQJ3HWUROHXP/LTXLG6WRUDJH9HVVHOVIRU:KLFK&RQVWUXFWLRQ5HFRQVWUXFWLRQRU 0RGLILFDWLRQ&RPPHQFHG$IWHU-XO\ $OOWDQNVFDQEHFDWHJRUL]HGDVDERYHJURXQGIL[HGURRIWDQNV7KHVHWDQNVDUHQRWVXEMHFWWRUHJXODWLRQV XQGHU16366XESDUW.E6WDQGDUGVRI3HUIRUPDQFHIRU9RODWLOH/LTXLG6WRUDJH9HVVHOVVLQFHDOOWDQNVPHHW RQHRIWKHWKUHHH[HPSWLRQVWRWKHUHJXODWLRQ Ź$FDSDFLW\RIOHVVWKDQFXELFPHWHUVP Ź$FDSDFLW\RIJUHDWHUWKDQRUHTXDOWRPDQGVWRULQJDOLTXLGZLWKDPD[LPXPWUXHYDSRU SUHVVXUHRIOHVVWKDQNLORSDVFDOVN3DRU Ź$FDSDFLW\RIEHWZHHQPDQGPDQGVWRULQJDOLTXLGZLWKDPD[LPXPWUXHYDSRUSUHVVXUHRI OHVVWKDQN3D 16366XESDUW2226WDQGDUGVRI3HUIRUPDQFHIRU1RQPHWDOOLF0LQHUDO3URFHVVLQJ3ODQWV 3HU&)5E 3HU&)5E .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW 16366XESDUW2226WDQGDUGVRI3HUIRUPDQFHIRU1RQPHWDOOLF0LQHUDO3URFHVVLQJ3ODQWVSURYLGHVWDQGDUGV RISHUIRUPDQFHIRUDIIHFWHGIDFLOLWLHVORFDWHGDWIL[HGRUSRUWDEOHQRQPHWDOOLFPLQHUDOSURFHVVLQJSODQWVWKDW DUHFRQVWUXFWHGPRGLILHGRUUHFRQVWUXFWHGDIWHU$XJXVW7KHIROORZLQJDUHFRQVLGHUHGDIIHFWHG IDFLOLWLHVXQGHU16366XESDUW222 Ź&UXVKHU Ź6FUHHQLQJ2SHUDWLRQ Ź%HOW&RQYH\RU Ź7KHSURSRVHGSURMHFWZLOOLQYROYHWKHLQVWDOODWLRQRIQRQPHWDOOLFPLQHUDODIIHFWHGIDFLOLWLHVXQGHU1636 6XESDUW222HJFUXVKHUVVFUHHQVFRQYH\RUEHOWVHWF3HU&)5DWKHDIIHFWHGIDFLOLWLHV PXVWPHHWWKHHPLVVLRQOLPLWVDQGFRPSOLDQFHUHTXLUHPHQWVLQ7DEOHRIWKHVWDQGDUGZLWKLQGD\V DIWHUDFKLHYLQJPD[LPXPSURGXFWLRQUDWHEXWQRODWHUWKDQGD\VDIWHULQLWLDOVWDUWXS0RQLWRULQJ PXVWEHFRQGXFWHGLQDFFRUGDQFHZLWK&)5FRUG)LQDOO\WHVWLQJUHFRUGNHHSLQJDQG UHSRUWLQJPXVWEHPHWLQDFFRUGDQFHZLWK&)5WKURXJK.LOJRUHZLOOGHPRQVWUDWH FRPSOLDQFHZLWKWKHUHTXLUHPHQWVXSRQFRPSOHWLRQRIFRQVWUXFWLRQRIWKHDIIHFWHGIDFLOLWLHV 7DEOH16366XESDUW2229LVLEOH(PLVVLRQV 5HTXLUHPHQW2SDFLW\/LPLW5HJXODWRU\ &LWDWLRQ ,)XJLWLYH(PLVVLRQ/LPLWV &UXVKHUV 2SDFLW\PXVWEHOHVVWKDQSHUFHQWIRUFUXVKHUVIRU ZKLFKDFDSWXUHV\VWHPLVQRWXVHG E 7DEOH ,,$GGLWLRQDO)XJLWLYH (PLVVLRQ/LPLWV ([FOXGLQJ&UXVKLQJ 2SDFLW\PXVWEHOHVVWKDQSHUFHQWIRUVFUHHQLQJ RSHUDWLRQVWUDQVIHUSRLQWVRQEHOWFRQYH\RUVRUIURP DQ\RWKHUDIIHFWHGIDFLOLW\ 7DEOH .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW$ )2506 Form 1 Date __________________ Notice of Intent (NOI) Application Checklist Company __________________ Utah Division of Air Quality New Source Review Section Source Identification Information [R307-401-5] 1. Company name, mailing address, physical address and telephone number 2. Company contact (Name, mailing address, and telephone number) 3. Name and contact of person submitting NOI application (if different than 2) 4. Source Universal Transverse Mercator (UTM) coordinates 5. Source Standard Industrial Classification (SIC) code 6. Area designation (attainment, maintenance, or nonattainment) 7. Federal/State requirement applicability (NAAQS, NSPS, MACT, SIP, etc.) 8. Source size determination (Major, Minor, PSD) 9. Current Approval Order(s) and/or Title V Permit numbers NOI Application Information:[R307-401] N/A N/A A. Air quality analysis (air model, met data, background data, source impact analysis) N/A Detailed description of the project and source process Discussion of fuels, raw materials, and products consumed/produced Description of equipment used in the process and operating schedule Description of changes to the process, production rates, etc. Site plan of source with building dimensions, stack parameters, etc. Best Available Control Technology (BACT) Analysis [R307-401-8] $BACT analysis for all new and modified equipment Emissions Related Information: [R307-401-2(b)] $Emission calculations for each new/modified unit and site-wide (Include PM10, PM2.5,NOx, SO2, CO, VOCs, HAPs, and GHGs) %References/assumptions, SDS, for each calculation and pollutant &All speciated HAP emissions (list in lbs/hr) Emissions Impact Analysis – Approved Modeling Protocol [R307-410] $Composition and physical characteristics of effluent (emission rates, temperature, volume, pollutant types and concentrations) Nonattainment/Maintenance Areas – Major NSR/Minor (offsetting only)[R307-403] $NAAQS demonstration, Lowest Achievable Emission Rate, Offset requirements %Alternative site analysis, Major source ownership compliance certification Major Sources in Attainment or Unclassified Areas (PSD) [R307-405, R307-406] %Visibility impact analysis, Class I area impact 6LJQDWXUHRQ$SSOLFDWLRQ N/A Note: The Division of Air Quality will not accept documents containing confidential information or data. Documents containing confidential information will be returned to the Source submitting the application. February 2022 ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ Kilgore Companies Page 1 of 1 Form 4 Company____________________________ Project Information Site ______________________________ Utah Division of Air Quality New Source Review Section Process Data -For Modification/Amendment ONLY 1. Permit Number_______________________________ If submitting a new permit, then use Form 3 Requested Changes 2. Name of process to be modified/added: _______________________________ End product of this process: _______________________________ 3. Permit Change Type: New Increase* Equipment Process Condition Change ____________________ Other ______________________________ Other ______________________________ Other ______________________________ 4. Does new emission unit affect existing permitted process limits? Yes No 5. Condition(s) Changing: 6. Description of Permit/Process Change** 7. New or modified materials and quantities used in process. ** Material Quantity Annually 8. New or modified process emitting units ** Emitting Unit(s) Capacity(s) Manufacture Date(s) *If the permit being modified does not include CO2e or PM2.5, the emissions need to be calculated and submitted to DAQ, which may result in an emissions increase and a public comment period. **If additional space is required, please generate a document to accommodate and attach to form. 4FF"UUBDIFEGPS&NJTTJPO*OGPSNBUJPO DAQE-AN158520001-18 Aggregate mine and HMA plant Processed aggregate and asphalt ✔ ✔ Yes ✔ II.B.2.a - Increased aggregate production II.B.2.f - Increased blasted area II.B.3.a - Increased acreage II.B.4.a - Increased asphalt production Increasing mining, processing, and sale of aggregate from aggregate facility, and increasing asphalt production in the HMA facility. Aggregate (tpy) 200,000.00 Asphalt (tpy) 40,000.00 Page 1 of 1 Company___________________________ 6LWH_____________________________ Form Emissions Information Criteria/GHGs/ HAP’s Utah Division of Air Quality New Source Review Section Potential to Emit* Criteria Pollutants & GHGs Criteria Pollutants Permitted Emissions (tons/yr) Emissions Increases (tons/yr) Proposed Emissions (tons/yr) PM10 Total PM10 Fugitive PM2.5 NOx SO2 CO VOC VOC Fugitive NH3 Greenhouse Gases CO2e CO2e CO2e CO2 CH4 N2O HFCs PFCs SF6 Total CO2e *Potential to emit to include pollution control equipment as defined by R307-401-2. Hazardous Air Pollutants**(**Defined in Section 112(b) of the Clean Air Act ) Hazardous Air Pollutant*** Permitted Emissions (tons/yr) Emission Increase (tons/yr) Proposed Emission (tons/yr) Emission Increase (lbs/hr) Total HAP *** Use additional sheets for pollutants if needed 4FF"UUBDIFEGPS &NJTTJPO*OGPSNBUJPO 4FF"UUBDIFEGPS &NJTTJPO*OGPSNBUJPO 4FF"UUBDIFEGPS &NJTTJPO*OGPSNBUJPO Kilgore Companies Benjamin Pit Utah Division of Air Quality Date _______________________________________ New Source Review Section Company_____________________________ Site ___ Form 15 Aggregate Processing Operations Equipment Information 1. Check the appropriate crushing operations used in your process: Type of Unit ___________________________ Manufacturer/Model________________________ Design Capacity______________________tons/hr Date Manufactured ________________________ _ Primary Crushing type _ Cone _ Jaw _ Ball _ Secondary Crushing type _ Cone _ Jaw _ Ball _ Tertiary Crushing type _ Cone _ Jaw _ Ball Screen Manufacturer __________________________ Model and Date Manufactured __________________ Screen type and size (triple, double, or single deck) _________________________________ 2. Dust sources will be controlled as follows: No Pre Water Bag Other Control Soaked Spray house (explain) _ Feed hopper __ __ _ _ All belt transfer points __ __ _ _ Inlet to all crushers __ __ _ _ Exit of all crushers __ __ _ _ All shaker screens __ __ _ 3. Water Sprays Total Water Rate to nozzles (gal/min): __________ Nozzle pressure (psi): _____________ Quantity of nozzles at each spray bar location: ______________ 4. Maximum Plant Production Rate and Operating Hours: _______ tons/yr ________ tons/hr _______ hrs/yr ________ hrs/day 5. Water sprays used on storage piles? _ Yes _ No Storage pile size:____________________ 6a. Number of conveyor belt transfer and drop points: 6b. List manufactured dates for all conveyor belts NOTE: 1. Submit this form in conjunction with Form 1 and Form 2. 2. To relocate an Aggregate Plant submit Form 15b. 3. Call the Division of Air Quality (DAQ) at (801) 536-4000 if you have problems or questions in filling out this form. Ask to speak with a New Source Review engineer. We will be glad to help! 4. Equipment listed on this form may be subject to New Source Performance Standards. If so, additional information may be requested for the engineering review. Instructions 1. Indicate the type, manufacturer/model, design capacity and manufactured date of the equipment. Mark the appropriate box for the kind of crushing at the facility and indicate the type (cone, ball, jaw) of crushing being done. 2. Mark the appropriate box for the control device for the emission points. 3. List the specifications of the water sprays. Check vendor literature or call sales agent. 4 Indicate the maximum amount of product that will be processed by the facility in tons per hour, the number of hours the facility will be run per day and number of days/year. 5. Are water sprinklers used on storage piles? Indicate the size of the storage piles. 6. Provide the number of belt drop points and list manufactured dates for all your conveyor belts. N:\engineers\ehe\word\form\Form 15 Aggregate Processing Operations Revised 12/20/2010 February 2022 Kilgore Companies Benjamin Pit ✔ 400 ✔✔ ✔ ✔✔✔ ✔ ✔✔ ✔✔ ✔✔ Triple deck As needed Permitted production rate: 600,000 tpy Project increase: 200,000 tpy ✔31 conveyor belts 3 acre increase Utah Division of Air Quality New Source Review Section Company _______________________ Site/Source _____________________ Form 19 Date ___________________________ Natural Gas Boilers and Liquid Heaters Boiler Information 1. Boiler Manufacturer: ___________________________________________________________________________ 2. Model Number: ______________________________ 3. Serial Number: _______________________________ 4. Boiler Rating: _________________(106 Btu per Hour) 5. Operating Schedule: __________ hours per day __________ days per week ___________ weeks per year 6. Use: Ƒ steam: psig Ƒ hot water Ƒ other hot liquid: ________________________________ Ƒ Natural Gas Ƒ LPG Ƒ Butane Ƒ Methanol Ƒ Process Gas - H2S content in process gas __________ grain/100cu.ft. 7. Fuels: Ƒ Fuel Oil - specify grade: Ƒ Other, specify: ______________________________________ Sulfur content % by weight Days per year during which unit is oil fired: ________________ Backup Fuel Ƒ Diesel Ƒ Natural Gas Ƒ LPG Ƒ Butane Ƒ Methanol Ƒ Other _________________ 8. Is unit used to incinerate waste gas liquid stream? Ƒ yes Ƒ no (Submit drawing of method of waste stream introduction to burners) Gas Burner Information 9. Gas Burner Manufacturer: _____________________________________________________________________ 10. No. of Burners: ______________________________ 11. Minimum rating per burner: _____________ cu. ft/hr 12. Average Load: _______% 13. Maximum rating per burner: ____________ cu. ft/hr 14. Performance Guarantee (ppm dry corrected to 3% Oxygen): NOx: ______________ CO: ______________ Hydrocarbons: ______________ Ƒ Manual Ƒ Automatic on-off 15. Gas burner mode of control: Ƒ Automatic hi-low Ƒ Automatic full modulation Oil Burner Information 16. Oil burner manufacturer: 17. Model: _______________ number of burners: _________________ Size number: _______________ 18. Minimum rating per burner: _____________ gal/hr 19. Maximum rating per burner: ___________ gal/hr Page 1 of 3 Kilgore Companies Benjamin Pit February 2022 NA - No boiler on site NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA 1 Page 2 of 3 Form 11 - Natural Gas Boiler and Liquid Heater (Continued) Modifications for Emissions Reduction 20. Type of modification: Ƒ Low NOX Burner Ƒ Flue Gas Recirculation (FGR) Ƒ Oxygen Trim Ƒ Other (specify) ______________________________________ For Low-NOX Burners 21. Burner Type: Ƒ Staged air Ƒ Staged fuel Ƒ Internal flue gas recirculation Ƒ Ceramic Ƒ Other (specify): ___________________________________________________ 22. Manufacturer and Model Number: _______________________________________________________________ 23. Rating: ______________________ 10 6 BTU/HR 24. Combustion air blower horsepower: ____________ For Flue Gas Recirculation (FGR) 25. Type: Ƒ Induced Ƒ Forced Recirculation fan horsepower: ______________________________________ 26. FGR capacity at full load: scfm %FGR 27. FGR gas temperature or load at which FGR commences: OF % load 28. Where is recirculation flue gas reintroduced? _______________________________________________________ For Oxygen Trim Systems 29. Manufacturer and Model Number: ________________________________________________________________ 30. Recorder: Ƒ yes Ƒ no Describe: ____________________________________________________________ Stack or Vent Data 31. Inside stack diameter or dimensions ____________ Stack height above the ground ________________ Stack height above the building ________________ 32. Gas exit temperature: ___________ OF 33. Stack serves: Ƒ this equipment only, Ƒ other equipment (submit type and rating of all other equipment exhausted through this stack or vent) 34. Stack flow rate: _________________ acfm Vertically restricted? Ƒ Yes Ƒ No Emissions Calculations (PTE) 35. Calculated emissions for this device PM10 ___________Lbs/hr___________ Tons/yr PM2.5 ___________Lbs/hr___________ Tons/yr NOx ___________Lbs/hr ___________Tons/yr SOx ____________Lbs/hr___________ Tons/yr CO ____________Lbs/hr ___________Tons/yr VOC ___________Lbs/hr ___________Tons/yr CO2 ___________ Tons/yr CH4 ___________Tons/yr N2O ___________Tons/yr HAPs_________ Lbs/hr (speciate)__________Tons/yr (speciate) Submit calculations as an appendix. If other pollutants are emitted, include the emissions in the appendix. ■ Various ■ See Modeling Report ■ See Appendix C Utah Division of Air Quality New Source Review Section Company _______________________ Site/Source _____________________ Form 19 Date ___________________________ Natural Gas Boilers and Liquid Heaters Boiler Information 1. Boiler Manufacturer: ___________________________________________________________________________ 2. Model Number: ______________________________ 3. Serial Number: _______________________________ 4. Boiler Rating: _________________(106 Btu per Hour) 5. Operating Schedule: __________ hours per day __________ days per week ___________ weeks per year 6. Use: Ƒ steam: psig Ƒ hot water Ƒ other hot liquid: ________________________________ Ƒ Natural Gas Ƒ LPG Ƒ Butane Ƒ Methanol Ƒ Process Gas - H2S content in process gas __________ grain/100cu.ft. 7. Fuels: Ƒ Fuel Oil - specify grade: Ƒ Other, specify: ______________________________________ Sulfur content % by weight Days per year during which unit is oil fired: ________________ Backup Fuel Ƒ Diesel Ƒ Natural Gas Ƒ LPG Ƒ Butane Ƒ Methanol Ƒ Other _________________ 8. Is unit used to incinerate waste gas liquid stream? Ƒ yes Ƒ no (Submit drawing of method of waste stream introduction to burners) Gas Burner Information 9. Gas Burner Manufacturer: _____________________________________________________________________ 10. No. of Burners: ______________________________ 11. Minimum rating per burner: _____________ cu. ft/hr 12. Average Load: _______% 13. Maximum rating per burner: ____________ cu. ft/hr 14. Performance Guarantee (ppm dry corrected to 3% Oxygen): NOx: ______________ CO: ______________ Hydrocarbons: ______________ Ƒ Manual Ƒ Automatic on-off 15. Gas burner mode of control: Ƒ Automatic hi-low Ƒ Automatic full modulation Oil Burner Information 16. Oil burner manufacturer: 17. Model: _______________ number of burners: _________________ Size number: _______________ 18. Minimum rating per burner: _____________ gal/hr 19. Maximum rating per burner: ___________ gal/hr Page 1 of 3 Kilgore Companies Benjamin Pit February 2022 NA - No boiler on site NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA 1 Page 2 of 3 Form 11 - Natural Gas Boiler and Liquid Heater (Continued) Modifications for Emissions Reduction 20. Type of modification: Ƒ Low NOX Burner Ƒ Flue Gas Recirculation (FGR) Ƒ Oxygen Trim Ƒ Other (specify) ______________________________________ For Low-NOX Burners 21. Burner Type: Ƒ Staged air Ƒ Staged fuel Ƒ Internal flue gas recirculation Ƒ Ceramic Ƒ Other (specify): ___________________________________________________ 22. Manufacturer and Model Number: _______________________________________________________________ 23. Rating: ______________________ 106 BTU/HR 24. Combustion air blower horsepower: ____________ For Flue Gas Recirculation (FGR) 25. Type: Ƒ Induced Ƒ Forced Recirculation fan horsepower: ______________________________________ 26. FGR capacity at full load: scfm %FGR 27. FGR gas temperature or load at which FGR commences: OF % load 28. Where is recirculation flue gas reintroduced? _______________________________________________________ For Oxygen Trim Systems 29. Manufacturer and Model Number: ________________________________________________________________ 30. Recorder: Ƒ yes Ƒ no Describe: ____________________________________________________________ Stack or Vent Data 31. Inside stack diameter or dimensions ____________ Stack height above the ground ________________ Stack height above the building ________________ 32. Gas exit temperature: ___________ OF 33. Stack serves: Ƒ this equipment only, Ƒ other equipment (submit type and rating of all other equipment exhausted through this stack or vent) 34. Stack flow rate: _________________ acfm Vertically restricted? Ƒ Yes Ƒ No Emissions Calculations (PTE) 35. Calculated emissions for this device PM10 ___________Lbs/hr___________ Tons/yr PM2.5 ___________Lbs/hr___________ Tons/yr NOx ___________Lbs/hr ___________Tons/yr SOx ____________Lbs/hr___________ Tons/yr CO ____________Lbs/hr ___________Tons/yr VOC ___________Lbs/hr ___________Tons/yr CO2 ___________ Tons/yr CH4 ___________Tons/yr N2O ___________Tons/yr HAPs_________ Lbs/hr (speciate)__________Tons/yr (speciate) Submit calculations as an appendix. If other pollutants are emitted, include the emissions in the appendix. ■ Various ■ See Modeling Report See Appendix C .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW% (0,66,21&$/&8/$7,216 Appendix B - Emissions Calculations Description Value Unit Potential Daily Operating Hours 24 (hr/day) Desired Annual Operating Days 365 (day/yr) Maximum Hourly Throughput 400 (tph) Site-wide Throughput: Mined Aggregate 800,000 (tpy) Site-wide Throughput: Diesel 800 (tpy) Site-wide Throughput: RFO 1,000 (tpy) Site-wide Throughput: Asphalt 250,000 (tpy) Site-wide Throughput: Asphalt Oil 15,000 (tpy) Site-wide Throughput: RAP 50,000 (tpy) Site-wide Throughput: Lime 735 (tpy) Site-wide Throughput: Fly Ash 735 (tpy) Site-wide Throughput: HMA Aggregate 183,530 (tpy) Throughput Percent Maximum Hourly Limit Potential Annual Throughput Potential Total Annual Throughput (%) (tph) (tpy/unit) (tpy) Primary Jaw Crusher 1 Aggregate Pit 100.00% 450 800,000 800,000 Secondary Cone Crusher 1 Aggregate Pit 70.00% 450 560,000 560,000 Tertiary VSI Crusher 1 Aggregate Pit 35.00% 450 280,000 280,000 Feeder 1 Aggregate Pit 100.00% 450 800,000 800,000 Primary Triple-Deck Screen 1 Aggregate Pit 100.00% 450 800,000 800,000 Secondary Triple-Deck Screen 1 Aggregate Pit 75.00% 450 600,000 600,000 Tertiary Triple-Deck Screen 1 Aggregate Pit 105.00% 450 840,000 840,000 Conveyor AGG1 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG2 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG3 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG4 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG5 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG6 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG7 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG8 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG9 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG10 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG11 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG12 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG13 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG14 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG15 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG16 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG17 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG18 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG19 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG20 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG21 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG22 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG23 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG24 1 Aggregate Pit 100.00% 450 800,000 800,000 Conveyor AGG25 1 Aggregate Pit 100.00% 450 800,000 800,000 Stacker 1 1 Aggregate Pit 10.00% 450 80,000 80,000 Stacker 2 1 Aggregate Pit 35.00% 450 280,000 280,000 Stacker 3 1 Aggregate Pit 15.00% 450 120,000 120,000 Stacker 4 1 Aggregate Pit 15.00% 450 120,000 120,000 Stacker 5 1 Aggregate Pit 15.00% 450 120,000 120,000 Stacker 6 1 Aggregate Pit 10.00% 450 80,000 80,000 Loader to Agg Feeder 1 Aggregate Pit 100.00% 450 800,000 800,000 Loader to Agg Haul Trucks (Product) 1 Aggregate Pit 100.00% 450 800,000 800,000 Loader to Agg Stockpiles 1 Aggregate Pit 100.00% 450 800,000 800,000 Loader to Agg Bins 1 HMA Plant 73.41% 400 183,530 183,530 Loader to RAP Bins 1 HMA Plant 20.00% 400 50,000 50,000 Bin Feeders (RAP) 3 HMA Plant 20.00%400 16,667 50,000 Bin Feeders (Aggregate) 5 HMA Plant 73.41% 400 36,706 183,530 Conveyor HMA1 1 HMA Plant 73.41% 400 183,530 183,530 Conveyor HMA2 1 HMA Plant 73.41%400 183,530 183,530 Conveyor HMA3 1 HMA Plant 73.41% 400 183,530 183,530 Conveyor HMA4 1 HMA Plant 73.41% 400 183,530 183,530 Conveyor HMA5 1 HMA Plant 20.00% 400 50,000 50,000 Conveyor HMA6 1 HMA Plant 20.00% 400 50,000 50,000 Scalping Screen 1 HMA Plant 100.00% 400 250,000 250,000 *Taken from 2019 Emissions Inventory. Location1 Table C-2. Equipment List Table C-1. Operating Parameters Type of Equipment / Activities Number of Units or Drop Points Kilgore Companies Benjamin Pit Page 1 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Table C-3. Stockpiles and Disturbed Grounds Type of Equipment / Activities1 Quantity Maximum Area (Acres) Stockpile 1 1 1.69 Stockpile 2 1 1.69 Stockpile 3 1 1.69 Stockpile 4 1 1.69 Stockpile 5 1 1.69 Stockpile 6 1 1.69 Stockpile 7 1 1.69 Stockpile 8 1 1.69 Stockpile 9 1 1.69 Stockpile 10 1 1.69 Disturbed Ground 1 1.09 Total -- 18.00 Maximum Annual Operating Hours (hr/yr/unit) Front-End Loaders Various 8,760 Bulldozers 1 1,800 Rating Max. Hourly Limit Fuel Usage (MMBtu/hr) (hr/yr/unit) (gal/yr) or (MMscf/yr) Hot Oil Heater 1 0.25 8,760 RFO 20,000 Drum-Mix Dryer 1 -- -- RFO 230,000 Parameter1 Quantity Unit Total Main Haul Road Distance (Aggregate)2 1.84 (miles) Paved Distance 0.57 (miles) Unpaved Distance 1.27 (miles) Total Main Haul Road Distance (HMA)3 1.08 (miles) Paved Distance 0.57 (miles) Unpaved Distance 0.51 (miles) Total Distance of Loader to Aggregate Stockpiles 0.04 (miles) Paved Distance 0.00 (miles) Unpaved Distance 0.04 (miles) Total Distance of Loader to Aggregate Haul Trucks 0.02 (miles) Paved Distance 0.00 (miles) Unpaved Distance 0.02 (miles) Total Distance of Loader to Agg Feeder, Agg Bins, RAP Bins 0.05 (miles) Paved Distance 0.00 (miles) Unpaved Distance 0.05 (miles) Empty Aggregate, RAP, & Asphalt Oil Haul Trucks 15.00 (tons) Loaded Aggregate, RAP, & Asphalt Oil Haul Trucks 57.00 (tons) Empty Diesel & RFO Haul Trucks 15.00 (tons) Loaded Diesel & RFO Haul Trucks 29.00 (tons) Empty Lime Haul Trucks 15.00 (tons) Loaded Lime Haul Trucks 42.00 (tons) Empty Asphalt Haul Trucks 15.00 (tons) Loaded Asphalt Haul Trucks 47.00 (tons) Empty Loader Weight 33.50 (tons) Loaded Loader Weight 43.50 (tons) Table C-4. Supporting Equipment 1. All haul and tram route distances are given as roundtrip distances. Table C-5. Miscellaneous Combustion Equipment QuantityType of Equipment Table C-6. Roads Fuel Type Type of Equipment Quantity 2. Includes haul trucks that haul processed aggregate off site and that haul diesel for aggregate operations on site. 3. Includes haul trucks that haul RAP, asphalt oil, diesel for HMA operations, waste oil for HMA operations, and lime on site, as well as those haul trucks that haul product HMA off site. Kilgore Companies Benjamin Pit Page 2 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Type of Equipment Configuration1 Capacity (gal) Capacity (ton) Contents Annual Throughput Units Diesel Tank 1 HFR 1,200 --Diesel 40,000 (gal/yr) Diesel Tank 2 HFR 1,200 --Diesel 40,000 (gal/yr) Diesel Tank 3 HFR 1,200 --Diesel 40,000 (gal/yr) Diesel Tank 4 HFR 1,200 --Diesel 40,000 (gal/yr) Diesel Tank 5 HFR 1,200 --Diesel 40,000 (gal/yr) RFO Tank HFR 15,000 --Waste Oil (RFO) 250,000 (gal/yr) Asphalt Oil Tank 1 HFR 30,000 --Asphalt Oil 5,000 (tpy) Asphalt Oil Tank 2 HFR 30,000 --Asphalt Oil 5,000 (tpy) Asphalt Oil Tank 3 HFR 30,000 --Asphalt Oil 5,000 (tpy) Lime Silo -- --40 Lime 735 (tpy) Fly Ash Silo -- --30 Fly Ash 735 (tpy) HMA Silo 1 -- --300 HMA 83,333 (tpy) HMA Silo 2 -- --300 HMA 83,333 (tpy) HMA Silo 3 -- -- 300 HMA 83,333 (tpy) 9 -- 5 -- VFR = Vertical Fixed Roof *Percent of diesel usage at aggregate facility: 21% Percent of diesel usage at HMA facility: 79% **Density (lb/gal) of No. 2 fuel oil, per AP-42 Section 1.3: 7.05 ***Density (lb/gal) of No. 6 fuel oil, per AP-42 Section 1.3: 7.88 Table C-8. Drilling and Blasting Parameter Blasting Units Drilling Units Daily Maximum Frequency 1 (blast/day) 135 (holes/day) Annual Maximum Frequency 30 (blasts/yr) 4,000 (holes/yr) Annual Maximum Area 185,856 (ft2/yr)-- -- Daily Maximum Area 6,262 (ft2/day)-- -- ANFO Usage 8,500 (lbs/blast) -- -- Maximum Annual ANFO Usage 126 (tpy) -- -- ANFO Heat Content 912 (cal/g) -- -- Location Specification Value Unit Dozers2 Moisture 7.90 % Dozers2 Silt 6.90 % Loaders1 Moisture 2.00 % Loaders3 Silt 4.80 % Roads3 Silt 4.80 % 3. Per UDAQ Guidance in "Emission Factors for Paved and Unpaved Haul Roads", January 12, 2015. 2. Per AP-42 Section 11.9 for Overburden. 1. Moisture content for dozers was previously recommended by UDAQ. Table C-9. Silt and Moisture Values 1. HFR = Horizontal Fixed Roof Total Number of Silos Total Number of Tanks Table C-7. Tanks/Silos Kilgore Companies Benjamin Pit Page 3 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations PM10 PM10 (Fugitive)PM2.5 NOX CO SO2 VOC CO2e Site-wide PTE 18.49 15.44 7.72 4.44 19.22 7.25 6.21 3,041.59 Permitted Emissions 12.80 NA 5.43 6.41 16.29 4.95 5.17 5,241.00 Site-wide PTE Increase 5.69 -- 2.29 -1.97 2.93 2.30 1.04 -2,199.41 Project Production Increase 5.04 4.52 2.01 1.18 3.38 1.16 1.03 430.58 Results of Emission Factor Adjustments to Existing Sources 0.65 -- 0.28 -3.15 -0.45 1.14 0.01 -2,629.99 Major Source Thresholds1,2 70 NA 70 70 100 70 70 NA Threshold Exceeded?No NA No No No No No No Modeling Limits3 15 5 No Limit 40 100 40 No Limit No Limit Threshold Exceeded?No NA No No No No No No 3. Per Emissions Impact Assessment Guidelines published by UDAQ. Table C-8. Facility-Wide Emissions Emissions (tpy) 1. The Benjamin Pit is located in Utah County, which is in serious nonattainment for PM2.5 and marginal nonattainment for ozone. Values are per UAC R307-403-5(2)(b)(ii). 2. Ammonia emissions were considered for the Benjamin Pit's facility-wide emissions; however, these emissions are not applicable. Kilgore Companies Benjamin Pit Page 4 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Process PM10 (tpy) PM2.5 (tpy) NOX (tpy) CO (tpy) SO2 (tpy) VOC (tpy) CO2e (tpy) Crushing and Screening Operations 1.01 0.24 0.00 0.00 0.00 0.00 0.00 Stockpiles and Disturbed Grounds 6.04 3.46 0.00 0.00 0.00 0.00 0.00 Bulldozers & Drops 1.37 0.29 0.00 0.00 0.00 0.00 0.00 Roads 6.92 0.69 0.00 0.00 0.00 0.00 0.00 Tanks 0.00 0.00 0.00 0.00 0.00 0.06 0.00 Silos 0.14 0.14 0.00 0.36 0.00 2.15 -- Hot Oil Heater 0.03 0.02 0.55 0.05 0.00 0.00 181.91 Drilling and Blasting 0.11 0.01 0.11 2.56 0.00 0.00 -- Drum-Mix Dryer 2.88 2.88 3.78 16.25 7.25 4.00 2,859.68 Total Potential Emissions (tpy)18.49 7.72 4.44 19.22 7.25 6.21 3,041.59 Table C-9. Annual Potential Emissions Increase Summary Proposed Project Emissions Kilgore Companies Benjamin Pit Page 5 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Quantity Quantity ETV1,2 (lb/hr) (tpy) (lb/hr) Acenaphthene 4.00E-05 1.75E-04 NA No Acenaphthylene 6.28E-04 2.75E-03 NA No Acetaldehyde 3.71E-02 1.63E-01 13.96268 No Acrolein 7.42E-04 3.25E-03 0.071078 No Anthracene 8.85E-05 3.88E-04 NA No Benzene 1.14E-02 4.98E-02 0.587822 No Benzo(a)anthracene 5.99E-06 2.63E-05 NA No Benzo(a)pyrene 2.80E-07 1.23E-06 NA No Benzo(b)fluoranthene 2.85E-06 1.25E-05 NA No Benzo(e)pyrene 3.14E-06 1.38E-05 NA No Benzo(g,h,i)perylene 1.14E-06 5.00E-06 NA No Benzo(k)fluoranthene 1.17E-06 5.13E-06 NA No Bromomethane 3.98E-05 1.74E-04 1.429104 No Carbon Disulfide 8.65E-05 3.79E-04 1.145993 No Chloroethane 1.44E-05 6.31E-05 97.10986 No Chloromethane 1.16E-04 5.06E-04 37.99656 No Chrysene 5.14E-06 2.25E-05 NA No Cumene 2.61E-04 1.14E-03 90.44973 No 1,4-Dichlorobenzene(p) 0.00E+00 0.00E+00 22.12666 No Dioxins 8.21E-08 3.60E-07 NA No Ethylbenzene 7.65E-03 3.35E-02 31.95655 No Fluoranthene 1.74E-05 7.63E-05 NA No Fluorene 3.14E-04 1.38E-03 NA No Formaldehyde 0.09115 3.99E-01 0.114225 No Furans 9.43E-08 4.13E-07 NA No Hexane 2.70E-02 1.18E-01 64.8553 No Indeno(1,2,3-cd)pyrene 2.00E-07 8.75E-07 NA No Isooctane (2,2,4-trimethylpentane) 1.14E-03 5.00E-03 NA No Methyl Chloroform (1,1,1-Trichloroethane) 5.39E-07 2.36E-06 702.8424 No Methylene Chloride 9.39E-07 4.11E-06 63.9146 No Methyl Ethyl Ketone 5.71E-04 2.50E-03 217.0372 No Naphthalene 1.89E-02 8.29E-02 19.29404 No Perylene 2.51E-07 1.10E-06 NA No Phenanthrene 6.56E-04 2.88E-03 NA No Phenol 2.30E-04 1.01E-03 7.082307 No POM 1.60E-03 7.03E-03 NA No Propionaldehyde 3.71E-03 1.63E-02 NA No Pyrene 8.56E-05 3.75E-04 NA No Quinone 4.57E-03 2.00E-02 0.162688 No Styrene 3.61E-05 1.58E-04 31.3545 No Tetrachloroethylene 1.83E-05 8.01E-05 62.38691 No Toluene 8.35E-02 3.66E-01 27.7332 No Xylene 7.77E-03 3.40E-02 159.7827 No 2-Methylnaphthalene 4.85E-03 2.13E-02 NA No Antimony 1.20E-05 5.25E-05 0.099 No Arsenic 1.90E-05 8.34E-05 0.00198 No Beryllium 6.73E-08 2.95E-07 9.9E-06 No Cadmium 1.26E-05 5.52E-05 0.000132 No Chromium 1.59E-04 6.96E-04 0.00066 No Chromium IV 5.66E-07 2.48E-06 NA No Cobalt 1.45E-05 6.35E-05 0.00396 No Hexavalent Chromium 1.28E-05 5.63E-05 NA No Lead 4.32E-04 1.89E-03 0.06 No Manganese 2.27E-04 9.93E-04 0.0396 No Mercury 7.45E-05 3.26E-04 0.00198 No Nickel 1.99E-03 8.72E-03 0.0066 No Phosphorus 2.18E-05 9.53E-05 0.0198 No Selenium 1.16E-05 5.06E-05 0.0396 No Maximum Project HAP 9.12E-02 3.99E-01 -- -- Total Project HAPs 3.07E-01 1.35E+00 -- -- Permitted HAPs NA 1.15E+00 -- -- Site-wide PTE NA 2.50E+00 -- -- 1. ETV limits per UDAQ list of HAPs and ETVs, at a distance to the property boundary of >100 m with vertically unrestricted releases. 2. Lead ETV measured in tons per year. Variable Table C-10. HAPs Emissions Metal HAPs Non-Metal HAPs Over ETV? Kilgore Companies Benjamin Pit Page 6 of 14 Trinity Consultants February 2022 Ap p e n d i x B - E m i s s i o n s C a l c u l a t i o n s PM 10 PM 2. 5 Pr i m a r y C r u s h i n g C o n t r o l l e d 1 . 3 5 E - 0 4 2 . 0 4 E - 0 5 Se c o n d a r y C r u s h i n g C o n t r o l l e d 2 . 7 0 E - 0 4 4 . 0 9 E - 0 5 Te r t i a r y C r u s h i n g C o n t r o l l e d 5 . 4 0 E - 0 4 1 . 0 0 E - 0 4 Pr i m a r y S c r e e n i n g C o n t r o l l e d 1 . 9 0 E - 0 4 5 . 0 0 E - 0 5 Se c o n d a r y S c r e e n i n g C o n t r o l l e d 3 . 7 0 E - 0 4 5 . 0 0 E - 0 5 Te r t i a r y S c r e e n i n g C o n t r o l l e d 7 . 4 0 E - 0 4 5 . 0 0 E - 0 5 Lo a d e r D r o p C o n t r o l l e d 7 . 2 1 E - 0 4 1 . 0 9 E - 0 4 St a c k e r D r o p C o n t r o l l e d 4 . 8 1 E - 0 4 7 . 2 8 E - 0 5 En c l o s e d D r o p C o n t r o l l e d 1 . 8 0 E - 0 4 9 . 1 0 E - 0 5 Co n v e y o r T r a n s f e r C o n t r o l l e d 4 . 6 0 E - 0 5 1 . 3 0 E - 0 5 P a r t i c l e s i z e m u l t i p l i e r (d i m e n s i o n l e s s ) PM PM 10 PM 2. 5 wh e r e : 0 . 7 4 0 . 3 5 0 . 0 5 3 1. E m i s s i o n f a c t o r s p e r E P A P o t e n t i a l t o E m i t Ca l c u l a t o r f o r S t o n e Q u a r r y i n g , C r u s h i n g , a n d Sc r e e n i n g P l a n t s l a s t u p d a t e d N o v e m b e r 2 0 1 3 a n d A P - 4 2 1 1 . 1 9 . 2 . 2. W h e r e P M 2. 5 e m i s s i o n f a c t o r s ( E F ) a r e n o t p r o v i d e d , a r a t i o o f a e r o d y n a m i c p a r t i c l e s i z e So u r c e 1, 2 Em i s s i o n F a c t o r (l b / t o n ) Ta b l e C - 1 1 . E m i s s i o n F a c t o r s f o r C r u s h i n g , S c r e e n i n g , & M a t e r i a l H a n d l i n g Ki l g o r e C o m p a n i e s Be n j a m i n P i t Pa g e 7 o f 1 4 Tr i n i t y C o n s u l t a n t s Fe b r u a r y 2 0 2 2 Ap p e n d i x B - E m i s s i o n s C a l c u l a t i o n s Th r o u g h p u t Pe r c e n t Po t e n t i a l A n n u a l Th r o u g h p u t (% ) ( t p y ) PM 10 PM 2. 5 PM 10 PM 2. 5 PM 10 PM 2. 5 Pr i m a r y C r u s h i n g P r i m a r y J a w C r u s h e r 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 1. 3 5 E - 0 4 2 . 0 4 E - 0 5 0 . 3 0 0 . 0 4 0 . 0 5 8 . 1 8 E - 0 3 Se c o n d a r y C r u s h i n g Se c o n d a r y C o n e Cr u s h e r 1 7 0 % 5 6 0 , 0 0 0 We t Su p p r e s s i o n 2. 7 0 E - 0 4 4 . 0 9 E - 0 5 0 . 41 0 . 0 6 0 . 0 8 1 . 1 4 E - 0 2 Te r t i a r y C r u s h i n g T e r t i a r y V S I C r u s h e r 1 3 5 % 2 8 0 , 0 0 0 We t Su p p r e s s i o n 5. 4 0 E - 0 4 1 . 0 0 E - 0 4 0 . 41 0 . 0 8 0 . 0 8 1 . 4 0 E - 0 2 Co n v e y o r T r a n s f e r F e e d e r 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 10 0 . 0 3 0 . 0 2 5 . 2 0 E - 0 3 Pr i m a r y S c r e e n i n g Pr i m a r y T r i p l e - D e c k Sc r e e n 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 1. 9 0 E - 0 4 5 . 0 0 E - 0 5 0 . 4 2 0 . 1 1 0 . 0 8 0 . 0 2 Se c o n d a r y S c r e e n i n g Se c o n d a r y T r i p l e - D e c k Sc r e e n 17 5 % 6 0 0 , 0 0 0 We t Su p p r e s s i o n 1. 9 0 E - 0 4 5 . 0 0 E - 0 5 0 . 3 1 0 . 0 8 0 . 0 6 1 . 5 0 E - 0 2 Te r t i a r y S c r e e n i n g Te r t i a r y T r i p l e - D e c k Sc r e e n 1 1 0 5 % 8 4 0 , 0 0 0 We t Su p p r e s s i o n 1. 9 0 E - 0 4 5 . 0 0 E - 0 5 0 . 4 4 0 . 1 2 0 . 0 8 2 . 1 0 E - 0 2 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 10 0 . 0 3 0 . 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 2 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 10 0 . 0 3 0 . 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 3 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2. 8 5 E - 0 2 0 . 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 4 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 10 0 . 0 3 0 . 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 5 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2. 8 5 E - 0 2 0 . 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 6 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 7 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 8 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 9 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 0 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 1 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 2 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 3 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 4 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 5 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 6 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 7 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 8 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Ta b l e C - 1 2 . A n n u a l A g g r e g a t e P r o c e s s e d Da i l y P T E E m i s s i o n s (l b / d a y ) An n u a l P T E E m i s s i o n s (t p y ) 1 Co n t r o l s 1 Nu m b e r o f U n i t s or D r o p P o i n t s Eq u i p m e n t / A c t i v i t y S o u r c e D e s c r i p t i o n Em i s s i o n F a c t o r (l b / t o n ) Ki l g o r e C o m p a n i e s Be n j a m i n P i t Pa g e 8 o f 1 4 Tr i n i t y C o n s u l t a n t s Fe b r u a r y 2 0 2 2 Ap p e n d i x B - E m i s s i o n s C a l c u l a t i o n s Th r o u g h p u t Pe r c e n t Po t e n t i a l A n n u a l Th r o u g h p u t (% ) ( t p y ) PM 10 PM 2. 5 PM 10 PM 2. 5 PM 10 PM 2. 5 Co n v e y o r T r a n s f e r C o n v e y o r A G G 1 9 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 2 0 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 2 1 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 2 2 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 2 4 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r A G G 2 5 1 1 0 0 % 8 0 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 1 0 2 . 85 E - 0 2 1 . 8 4 E - 0 2 5 . 2 0 E - 0 3 Co n v e y o r T r a n s f e r O v e r l a n d C o n v e y o r 1 0 % 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 0 0 0 . 00 E + 0 0 0 . 0 0 E + 0 0 0 . 0 0 E + 0 0 Co n v e y o r T r a n s f e r C o n v e y o r H M A 1 1 7 3 % 1 8 3 , 5 3 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 0 2 6 . 5 4 E - 0 3 4 . 2 2 E - 0 3 1 . 1 9 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r H M A 2 1 7 3 % 1 8 3 , 5 3 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 0 2 6 . 5 4 E - 0 3 4 . 2 2 E - 0 3 1 . 1 9 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r H M A 3 1 7 3 % 1 8 3 , 5 3 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 0 2 6 . 5 4 E - 0 3 4 . 2 2 E - 0 3 1 . 1 9 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r H M A 4 1 7 3 % 1 8 3 , 5 3 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 0 2 6 . 5 4 E - 0 3 4 . 2 2 E - 0 3 1 . 1 9 E - 0 3 Co n v e y o r T r a n s f e r C o n v e y o r H M A 5 1 2 0 % 5 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 0 1 1 . 78 E - 0 3 1 . 1 5 E - 0 3 3 . 2 5 E - 0 4 Co n v e y o r T r a n s f e r C o n v e y o r H M A 6 1 2 0 % 5 0 , 0 0 0 We t Su p p r e s s i o n 4. 6 0 E - 0 5 1 . 3 0 E - 0 5 0 . 0 1 1 . 78 E - 0 3 1 . 1 5 E - 0 3 3 . 2 5 E - 0 4 Te r t i a r y S c r e e n i n g Sc a l p i n g S c r e e n 1 1 0 0 % 2 5 0 , 0 0 0 We t Su p p r e s s i o n 7. 4 0 E - 0 4 5 . 0 0 E - 0 5 0 . 5 1 3 . 4 2 E - 0 2 9 . 2 5 E - 0 2 6 . 2 5 E - 0 3 5. 5 2 1 . 3 0 1 . 0 1 0 . 2 4 To t a l E m i s s i o n s : Ta b l e C - 1 2 . A n n u a l A g g r e g a t e P r o c e s s e d ( c o n t ' d ) Eq u i p m e n t / A c t i v i t y S o u r c e D e s c r i p t i o n Nu m b e r o f U n i t s or D r o p P o i n t s Co n t r o l s 1 Em i s s i o n F a c t o r (l b / t o n ) Da i l y P T E E m i s s i o n s (l b / d a y ) An n u a l P T E E m i s s i o n s (t p y ) 1 1 W a t e r a p p l i c a t i o n w i l l b e u s e d t o c o n t r o l P M e m i s s i o n s o n s t r a te g i c t r a n s f e r p o i n t s t h r o u g h o u t t h e c r u s h i n g a n d s c r e e n i n g o p e r at i o n s . Ki l g o r e C o m p a n i e s Be n j a m i n P i t Pa g e 9 o f 1 4 Tr i n i t y C o n s u l t a n t s Fe b r u a r y 2 0 2 2 Ap p e n d i x B - E m i s s i o n s C a l c u l a t i o n s PM 10 PM 2. 5 PM 10 PM 2. 5 PM 10 PM 2. 5 PM 10 PM 2. 5 PM 10 PM 2. 5 Ex i s t i n g S t o c k p i l e s 1 0 . 9 1 1 . 0 0 W a t e r A p p l i c a t i o n 6 . 3 0 1 . 8 5 1 . 8 9 1 . 1 1 2 0 . 6 2 1 2 . 1 1 0 . 8 6 0 . 5 0 3 . 7 6 2 . 2 1 Ne w S t o c k p i l e s 6 . 0 0 1 . 0 0 W a t e r A p p l i c a t i o n 6 . 3 0 1 . 8 5 1 . 8 9 1 . 1 1 1 1 . 3 4 6 . 6 6 0 . 4 7 0 . 2 8 2 . 0 7 1 . 2 2 Di s t u r b e d G r o u n d 1 . 0 9 1 . 0 0 W a t e r A p p l i c a t i o n 1 . 0 4 0 . 1 6 0 . 3 1 0 . 0 9 0 . 3 4 0 . 1 0 0 . 0 1 0 . 0 0 0 . 2 1 0 . 0 3 18 . 0 0 - - -- - - 3 2 . 3 0 1 8 . 8 7 1 . 3 5 0 . 7 9 6 . 0 4 3 . 4 6 TS P e m i s s i o n f a c t o r : 0 . 3 8 PM 10 c o n t e n t : PM 2. 5 c o n t e n t : PM T y p e W a t e r A p p l i c a t i o n W a t e r S a t u r a t i o n PM 10 C o n t r o l Ef f i c i e n c y 70 % 9 0 % PM 2. 5 C o n t r o l Ef f i c i e n c y 40 % 9 0 % 4 W h e r e n o P M 10 or P M 2. 5 e m i s s i o n f a c t o r w a s g i v e n , t h e f o l l o w i n g v a l u e s w e r e u s e d t o s o l v e f o r t h e em i s s i o n f a c t o r , p e r U . S . E P A A P - 4 2, S e c t i o n 1 3 . 2 . 5 , p a ge 1 3 . 2 . 5 - 3 ( I n d u s t r i a l W i n d E r o s i o n ) : 7 P M 10 a n d P M 2. 5 c o n t r o l e f f i c i e n c i e s f o r m o i s t u r e c a r r y o v e r a r e w e i g h t e d a c c o r d i n g t o U D A Q ' s g u i d e l i n e s f r o m d a t a r e c e i v e d f r o m A P - 4 2 A p p e n d i x B . 2 , T a b l e B . 2 - 3 . P M 10 a n d P M 2. 5 c o n t r o l e f f i c i e n c i e s f o r w a t e r s a t u r a t i o n a r e g i v e n p e r We s t e r n R e g i o n a l A i r P a r t n e r s h i p ' s ( W R A P ' s ) 2 0 0 6 F u g i t i v e D u s t H a n d b o o k v a l u e f o r w a t e r i n g o f s t o r a g e p i l e s . Ta b l e C - 1 3 . S t o c k p i l e s - P o t e n t i a l E m i s s i o n s 1 P M 10 e m i s s i o n f a c t o r s f o r s t o c k p i l e s t a k e n f r o m A P - 4 2 , F o u r t h E d i t i o n T a b l e 8 . 1 9 . 1 - 1 , p e r U D A Q g u i d a n c e . EF ( P M 2. 5 ) [ u n c o n t r o l l e d , i n a c t i v e ] = E F ( P M 2. 5 ) [ u n c o n t r o l l e d , a c t i v e ] * E F ( P M 10 ) [ u n c o n t r o l l e d , i n a c t i v e ] / E F ( P M 10 ) [ u n c o n t r o l l e d , a c t i v e ] 6 P M 2. 5 u n c o n t r o l l e d , i n a c t i v e e m i s s i o n f a c t o r f o r s t o c k p i l e s i s b a s e d o n t h e r a t i o o f t h e u n c o n t r o l l e d , a c t i v e P M 10 a n d P M 2. 5 e m i s s i o n f a c t o r s . 5 P M 10 u n c o n t r o l l e d , i n a c t i v e e m i s s i o n f a c t o r s f o r s t o c k p i l e s t a k e n f r o m A P - 4 2 F o u r t h E d i t i o n , T a b l e 8 . 1 9 . 1 - 1 . 0. 0 7 5 0. 5 0 to n / a c r e - y r Wh e r e : 3 P e r U . S . E P A A P - 4 2 , S e c t i o n 1 1 . 9 ( W e s t e r n S u r f a c e C o a l M i n i n g ) , T a b l e 1 1 . 9 - 4 ; A u g u s t 1 9 9 8 , f o r D i s t u r b e d A r e a . 2 P M 2. 5 em i s s i o n f a c t o r s f o r s t o c k p i l e s c a l c u l a t e d u s i n g d a t a f r o m A P - 4 2 A p p e n d i x B . 2 T a b l e B . 2 - 2 , p e r U D A Q g u i d a n c e . Lo c a t i o n Co n t r o l E f f i c i e n c y 7 An n u a l A c t i v e Em i s s i o n s (t p y ) To t a l So u r c e Ma x i m u m A r e a (A c r e s ) Ag g r e g a t e P i t Qu a n t i t y C o n t r o l Un c o n t r o l l e d A c t i v e Em i s s i o n F a c t o r (l b / d a y / a c r e ) 1, 2 , 3 Co n t r o l l e d A c t i v e Em i s s i o n F a c t o r (l b / d a y / a c r e ) Da i l y A c t i v e Em i s s i o n s (l b / d a y ) Ho u r l y A c t i v e Em i s s i o n s (l b / h r ) Ki l g o r e C o m p a n i e s Be n j a m i n P i t Pa g e 1 0 o f 1 4 Tr i n i t y C o n s u l t a n t s Fe b r u a r y 2 0 2 2 Appendix B - Emissions Calculations PM10 PM2.5 Bulldozing Operations 0.20 0.11 Loading Operations 1.16 0.18 Total Loading, Drop, and Dozing Emissions 1.37 0.29 (hr/yr)PM10 PM2.5 (%)PM10 PM2.5 PM10 PM2.5 Bulldozers 1,800 1 0.75 0.41 70% 1.11 0.61 0.20 0.11 1.11 0.61 0.20 0.11 where: s = 6.90 M = 7.90 PM10 PM2.5 Bulldozer 0.75 0.105 Per AP-42, Section 11.9 (October 1998), Table 11.9-1 Table C-16. Loader and Drop Emissions (Supporting Operations) (tpy)PM10 PM2.5 (%) (%) PM10 PM2.5 PM10 PM2.5 Loader to Agg Feeder 800,000 2.40E-03 3.64E-04 70% - 1.58 0.24 0.29 0.04 Loader to Agg Haul Trucks (Product)800,000 2.40E-03 3.64E-04 70% - 1.58 0.24 0.29 0.04 Loader to Agg Stockpiles 800,000 2.40E-03 3.64E-04 70% -1.58 0.24 0.29 0.04 Loader to Agg Bins 183,530 2.40E-03 3.64E-04 70% - 0.36 0.05 0.07 0.01 Loader to RAP Bins 50,000 2.40E-03 3.64E-04 70% - 0.10 0.01 0.02 2.73E-03 Bin Feeders (RAP) 50,000 2.40E-03 3.64E-04 70%75% 0.02 0.00 4.51E-03 6.83E-04 Bin Feeders (Aggregate) 183,530 2.40E-03 3.64E-04 70% 75% 0.09 0.01 1.66E-02 2.51E-03 Stacker 1 80,000 2.40E-03 3.64E-04 80% - 0.11 0.02 0.02 2.91E-03 Stacker 2 280,000 2.40E-03 3.64E-04 80% - 0.37 0.06 0.07 0.01 Stacker 3 120,000 2.40E-03 3.64E-04 80% - 0.16 0.02 0.03 0.00 Stacker 4 120,000 2.40E-03 3.64E-04 80% - 0.16 0.02 0.03 0.00 Stacker 5 120,000 2.40E-03 3.64E-04 80% - 0.16 0.02 0.03 0.00 Stacker 6 80,000 2.40E-03 3.64E-04 80% - 0.11 0.02 0.02 2.91E-03 6.37 0.97 1.16 0.18 E = Emission factor where: PM PM10 PM2.5 k = 0.74 0.35 0.053 U = 9.00 M = 2.00 Total Loading Emissions Primary Control Efficiency2 Daily Emissions (lb/day) Annual Emissions (tpy) Emission Factor1 (lb/hr) Material moisture content (%) per AP-42 11.9. Emission Activity Potential Total Annual Throughput Uncontrolled Emission Factor1 (lb/ton) Control Efficiency Daily Emissions (lb/day) Annual Emissions (tpy) Total Dozing Emissions: 1. Emissions for the bulldozer were characterized using AP-42, Section 11.9 (October 1998), Table 11.9-1 and Table 11.9-3 Percent (%) per AP-42 11.9. Secondary Control Efficiency3 Table C-14. Dozing and Loading Emissions Source Annual Emissions (tpy)2 Vehicle Type Maximum Annual Operating Hours Quantity Table C-15. Dozing Emissions 3. The bin feeders will have additional control efficiency in the form of partial enclosures, which the Western Regional Air Partnership's Fugitive Dust Handbook lists as 75% control for fugitive dust. 2. The C&S will implement water sprays, resulting in a 70% control efficiency, per the average control value for wet suppression in the WRAP Fugitive Dust Handbook, 2006. 1. Uncontrolled emission factors using the "drop equation" contained in U.S. EPA AP-42, Section 13.2.4 (Aggregate Handling and Storage Piles), November 2006: Particle size multiplier (dimensionless) Mean wind speed (mph) is given per UDAQ's Average Annual Wind Speed map, November 2000. Material moisture content (%) previously recommended by UDAQ. Kilgore Companies Benjamin Pit Page 11 of 14 Trinity Consultants February 2022 Ap p e n d i x B - E m i s s i o n s C a l c u l a t i o n s Ta b l e C - 1 7 . R o a d s E m i s s i o n s - P T E E m i s s i o n s PM 10 PM 2. 5 PM 10 PM 2. 5 Un p a v e d , C h e m i c a l A p p l i c a t i o n ( T r u c k s ) 2 5 . 0 7 2 . 5 1 4. 5 8 0 . 4 6 Un p a v e d , C h e m i c a l A p p l i c a t i o n (L o a d e r s ) 7. 7 7 0 . 7 8 1. 4 2 0 . 1 4 Pa v e d , W a t e r e d , V a c u u m S w e p t ( T r u c k s ) 4 . 7 6 0 . 4 8 0. 8 7 0 . 0 9 To t a l 3 7 . 9 0 3 . 7 9 6 . 9 2 0 . 6 9 Ta b l e C - 1 8 . R o a d s E m i s s i o n s - T r a v e l i n g P a r a m e t e r s ( S u p p o r t i n g O p e r a t i o n s ) Em p t y V e h i c l e L o a d e d V e h i c l e (t p y ) ( t o n s ) ( t o n s ) ( t o n s / h a u l ) Pr o c e s s e d A g g r e g a t e H a u l T r u c k s 8 0 0 , 0 0 0 1 5 . 0 0 5 7 . 0 0 4 2 5 3 1 . 2 7 0 . 5 7 6 7 . 2 5 3 0 . 1 1 24 , 5 4 8 1 0 , 9 9 1 Di e s e l H a u l T r u c k s ( A g g r e g a t e ) 1 6 8 1 5 . 0 0 2 9 . 0 0 1 4 1 1 . 2 7 0 . 5 7 1 . 2 7 0 . 5 7 46 3 2 0 7 RA P H a u l T r u c k s 5 0 , 0 0 0 1 5 . 0 0 5 7 . 0 0 4 2 4 0 . 5 1 0 . 5 7 2 . 0 5 2 . 2 7 74 7 8 3 0 As p h a l t O i l H a u l T r u c k s 1 5 , 0 0 0 1 5 . 0 0 5 7 . 0 0 4 2 1 0 . 5 1 0 . 5 7 0 . 5 1 0 . 5 7 18 7 2 0 7 Di e s e l H a u l T r u c k s ( H M A ) 6 3 2 1 5 . 0 0 2 9 . 0 0 1 4 1 0 . 5 1 0 . 5 7 0 . 5 1 0 . 5 7 18 7 2 0 7 RF O H a u l T r u c k s 1 , 0 0 0 1 5 . 0 0 2 9 . 0 0 1 4 1 0 . 5 1 0 . 5 7 0 . 5 1 0 . 5 7 18 7 2 0 7 Li m e H a u l T r u c k s 7 3 5 1 5 . 0 0 4 2 . 0 0 2 7 1 0 . 5 1 0 . 5 7 0 . 5 1 0 . 5 7 18 7 2 0 7 As p h a l t P r o d u c t H a u l T r u c k s 2 5 0 , 0 0 0 1 5 . 0 0 4 7 . 0 0 3 2 2 2 0 . 5 1 0 . 5 7 1 1 . 2 5 1 2 . 5 0 4, 1 0 6 4 , 5 6 3 Lo a d e r t o A g g r e g a t e B i n s 1 8 3 , 5 3 0 3 3 . 5 0 4 3 . 5 0 1 0 5 1 0 . 0 5 0 . 0 0 2 . 4 1 0 . 0 0 88 1 0 Lo a d e r t o R A P B i n s 5 0 , 0 0 0 3 3 . 5 0 4 3 . 5 0 1 0 1 4 0 . 0 5 0 . 0 0 0 . 6 6 0 . 0 0 24 2 0 Lo a d e r t o A g g H a u l T r u c k s ( P r o d u c t ) 8 0 0 , 0 0 0 3 3 . 5 0 4 3 . 5 0 1 0 2 2 0 0 . 0 2 0 . 0 0 4 . 1 7 0 . 0 0 1, 5 2 1 0 Lo a d e r t o A g g F e e d e r 8 0 0 , 0 0 0 3 3 . 5 0 4 3 . 5 0 1 0 2 2 0 0 . 0 5 0 . 0 0 1 0 . 4 2 0 . 0 0 3, 8 0 2 0 Lo a d e r t o A g g S t o c k p i l e s 8 0 0 , 0 0 0 3 3 . 5 0 4 3 . 5 0 1 0 2 2 0 0 . 0 4 0 . 0 0 8 . 3 3 0 . 0 0 3, 0 4 2 0 An n u a l D a y s V e h i c l e s O p e r a t e : Ro a d S o u r c e Co n t r o l l e d E m i s s i o n s Da i l y E m i s s i o n s ( l b / d a y ) 1 An n u a l E m i s s i o n s ( t p y ) 1 Pr o d u c t Th r o u g h p u t Me a n V e h i c l e W e i g h s ( t o n s ) 1, 2 1 D a i l y a n d a n n u a l c o n t r o l l e d e m i s s i o n s a r e c a l c u l a t e d b y a p p l y i n g t h e c o n t r o l l e d e m i s s i o n f a c t o r ( p e r U D A Q ' s c o n t r o l e f f i c i e n c i es ) t o t h e ve h i c u l a r m i l e s t r a v e l e d p e r d a y ( p a v e d a n d u n p a v e d ) . Da i l y E m i s s i o n s ( l b / d a y ) = M i l e s T r a v e l l e d p e r D a y ( V M T / d a y ) * U n c o n t r o l l e d E m i s s i o n F a c t o r ( l b / V M T ) * ( 1 - ߟ) An n u a l E m i s s i o n s ( t p y ) = M i l e s T r a v e l l e d p e r D a y ( V M T / y r ) * U n c o n t r o l l e d E m i s s i o n F a c t o r ( l b / V M T ) * ( 1 - ߟ) Ro a d S o u r c e Ve h i c l e H a u l Ca p a c i t y To t a l T r a v e l Di s t a n c e p e r H a u l (m i l e s / h a u l ) Da i l y To t a l V e h i c l e M i l e s T r a v e l e d Ha u l s / Da y Un p a v e d U n p a v e d P a v e d Pa v e d P a v e d An n u a l (V M T / d a y ) Un p a v e d (V M T / y r ) 1 V e h i c l e w e i g h t s p e r h i s t o r i c a l E m i s s i o n s I n v e n t o r y d a t a . 2 Ma x i m u m G r o s s V e h i c l e W e i g h t ( G V W ) l i m i t a t i o n p e r R 9 0 9 - 2 - 5 T a b l e 2 . 36 5 Ki l g o r e C o m p a n i e s Be n j a m i n P i t Pa g e 1 2 o f 1 4 Tr i n i t y C o n s u l t a n t s Fe b r u a r y 2 0 2 2 Ap p e n d i x B - E m i s s i o n s C a l c u l a t i o n s Ta b l e C - 1 9 . R o a d s E m i s s i o n s - E m i s s i o n F a c t o r s PM 10 PM 2. 5 Un p a v e d N o n e 0 % 1 . 9 9 0 . 2 0 Un p a v e d Wa t e r i n g a n d Ro a d B a s e 75 % 0 . 5 0 0 . 0 5 Un p a v e d Ch e m i c a l Su p p r e s s a n t a n d Wa t e r i n g 85 % 0 . 3 0 0 . 0 3 Pa v e d Pa v e d R o a d Su r f a c e w i t h Va c u u m S w e e p i n g an d W a t e r i n g 95 % 0 . 1 0 0 . 0 1 wh e r e E = S i z e - s p e c i f i c e m i s s i o n f a c t o r ( l b / V M T ) k, a , b = C o n s t a n t s f o r e q u a t i o n 1 a PM PM 10 PM 2. 5 k = 4 . 9 1 . 5 0 . 1 5 a = 0. 7 0. 9 0 . 9 b = 0. 4 5 0. 4 5 0 . 4 5 s = s u r f a c e m a t e r i a l s i l t c o n t e n t ( % ) s = 4 . 8 W = 3 5 . 3 Ro a d S u r f a c e Co n t r o l s 1 Co n t r o l E f f i c i e n c y (% ) Ha u l T r u c k E m i s s i o n F a c t o r s 1 (l b / V M T ) Me a n w i e g h t o f a l l v e h i c l e s ( t o n s ) , p e r U D A Q g u i d a n c e g i v e n i n E m i s s i o n Fa c t o r s f o r P a v e d a n d U n p a v e d H a u l R o a d s , J a n u a r y 2 0 1 5 . Pe r U D A Q g u i d a n c e g i v e n i n E m i s s i o n Fa c t o r s f o r P a v e d a n d U n p a v e d H a u l Ro a d s , J a n u a r y 2 0 1 5 . 1 E m i s s i o n c o n t r o l s f o r v e h i c u l a r t r a f f i c o n p a v e d a n d u n p a v e d r o a d s p e r U D A Q g u i d e l i n e s : E m i s s i o n F a c t o r s f o r P a v e d a n d U n p a v e d H a u l Ro a d s , J a n u a r y 2 0 1 5 , i n c o n j u n c t i o n w i t h U . S . E P A A P - 4 2 S e c t i o n 1 3 . 2 . 2 , N o v e m b e r 2 0 0 6 . Ki l g o r e C o m p a n i e s Be n j a m i n P i t Pa g e 1 3 o f 1 4 Tr i n i t y C o n s u l t a n t s Fe b r u a r y 2 0 2 2 Ap p e n d i x B - E m i s s i o n s C a l c u l a t i o n s Di e s e l T a n k 1 HF R 1 1 , 2 0 0 D i e s e l 4 0 , 0 0 0 ( g a l / y r ) 6 . 3 1 E - 0 4 Di e s e l T a n k 2 HF R 1 1 , 2 0 0 D i e s e l 4 0 , 0 0 0 ( g a l / y r ) 6 . 3 1 E - 0 4 Di e s e l T a n k 3 HF R 1 1 , 2 0 0 D i e s e l 4 0 , 0 0 0 ( g a l / y r ) 6 . 3 1 E - 0 4 Di e s e l T a n k 4 HF R 1 1 , 2 0 0 D i e s e l 4 0 , 0 0 0 ( g a l / y r ) 6 . 3 1 E - 0 4 Di e s e l T a n k 5 HF R 1 1 , 2 0 0 D i e s e l 4 0 , 0 0 0 ( g a l / y r ) 6 . 3 1 E - 0 4 RF O T a n k HF R 1 1 5 , 0 0 0 W a s t e O i l ( R F O ) 2 5 0 , 0 0 0 ( g a l / y r ) 9 . 3 2 E - 0 4 As p h a l t O i l T a n k 1 HF R 1 3 0 , 0 0 0 A s p h a l t O i l 5 , 0 0 0 ( t p y ) 0 . 0 2 As p h a l t O i l T a n k 2 HF R 1 3 0 , 0 0 0 A s p h a l t O i l 5 , 0 0 0 ( t p y ) 0 . 0 2 As p h a l t O i l T a n k 3 HF R 1 3 0 , 0 0 0 A s p h a l t O i l 5 , 0 0 0 ( t p y ) 0 . 0 2 0. 0 6 3. H A P s w e r e c a l c u l a t e d f o r t a n k s e m i s s i o n s b u t h a v e n o t b e e n re p o r t e d d u e t o t h e i r i n s i g n i f i c a n t q u a n t i t i e s ( i . e . , < 1 . 0 0 E - 0 3 t py ) . Ta b l e C - 2 0 . S t o r a g e T a n k s 1. H F R = H o r i z o n t a l F i x e d R o o f 2. T a n k e m i s s i o n s c a l c u l a t e d p e r A P - 4 2 7 . 1 Or g a n i c L i q u i d S t o r a g e T a n k s . V F R = V e r t i c a l F i x e d R o o f To t a l V O C Em i s s i o n s 2, 3 ( t p y ) Co n t e n t s Ca p a c i t y (g a l ) Qu a n t i t y Co n f i g u r a t i o n 1 Ta n k A n n u a l T h r o u g h p u t U n i t s To t a l V O C E m i s s i o n s Ki l g o r e C o m p a n i e s Be n j a m i n P i t Pa g e 1 4 o f 1 4 Tr i n i t y C o n s u l t a n t s Fe b r u a r y 2 0 2 2 Appendix B - Emissions Calculations Table C-21. Asphalt Operations Inputs and Criteria Pollutant Emission Factors Operation Project Throughput (tpy) PM10 (lb/ton) PM2.5 4 (lb/ton) NOX (lb/ton) CO (lb/ton) SO2 (lb/ton) VOC (lb/ton) Asphalt Silo Loading1 250,000 5.86E-04 5.86E-04 -- 1.18E-03 -- 1.22E-02 Asphalt Loadout1 250,000 5.22E-04 5.22E-04 -- 1.35E-03 -- 3.91E-03 Asphalt Transport1 250,000 -- -- -- 3.52E-04 -- 1.10E-03 Lime Silo Loading (Pneumatic)2 735 3.40E-04 3.40E-04 -- -- -- -- Fly Ash Silo Loading (Pneumatic)3 735 4.90E-03 4.90E-03 -- -- -- -- Table C-22. Criteria Pollutant Emissions PM10 PM10 PM2.5 NOX CO SO2 VOC (tpy) (lb/day) (tpy) (tpy) (tpy) (tpy) (tpy) 7.32E-02 4.01E-01 7.32E-02 0.00E+00 1.47E-01 0.00E+00 1.52E+00 6.52E-02 3.57E-01 6.52E-02 0.00E+00 1.69E-01 0.00E+00 4.89E-01 0.00E+00 0.00E+00 0.00E+00 0.00E+00 4.40E-02 0.00E+00 1.38E-01 1.25E-04 6.85E-04 1.25E-04 0.00E+00 0.00E+00 0.00E+00 0.00E+00 1.80E-03 9.87E-03 1.80E-03 0.00E+00 0.00E+00 0.00E+00 0.00E+00 1.40E-01 -- 1.40E-01 0.00E+00 3.60E-01 0.00E+00 2.15E+00 Table C-23. HAPs Emission Factors from Asphalt Operations HAP Asphalt Silo Loading (lb/ton) Asphalt Loadout (lb/ton) Asphalt Transport (lb/ton) Lime Silo Loading (Pneumatic) (lb/ton) Fly Ash Silo Loading (Pneumatic) (lb/ton) Benzene 3.90E-06 2.16E-06 2.16E-06 ---- Bromomethane 5.97E-07 3.99E-07 3.99E-07 ---- Carbon Disulfide 1.95E-06 5.41E-07 5.41E-07 ---- Chloroethane 4.87E-07 8.73E-09 8.73E-09 ---- Chloromethane 2.80E-06 6.24E-07 6.24E-07 ---- Cumene -- 4.57E-06 4.57E-06 ---- Ethylbenzene 4.63E-06 1.16E-05 1.16E-05 ---- Formaldehyde 8.41E-05 3.66E-06 3.66E-06 ---- Hexane 1.22E-05 6.24E-06 6.24E-06 ---- Isooctane (2,2,4-trimethylpentane) 3.78E-08 7.49E-08 7.49E-08 ---- Methylene Chloride 3.29E-08 -- -- ---- Naphthalene 4.62E-06 4.26E-06 4.26E-06 ---- Phenol -- 4.02E-06 4.02E-06 ---- POM 2.43E-05 1.60E-05 1.60E-05 ---- Styrene 6.58E-07 3.04E-07 3.04E-07 ---- Tetrachloroethylene -- 3.20E-07 3.20E-07 ---- Toluene 7.56E-06 8.73E-06 8.73E-06 ---- Xylene 3.13E-05 2.04E-05 2.04E-05 -- -- Arsenic -- -- -- 4.24E-09 5.02E-07 Beryllium -- -- -- 4.86E-10 4.52E-08 Cadmium -- -- -- 4.68E-09 9.92E-09 Chromium -- -- -- 2.90E-08 6.10E-07 Lead -- -- -- 1.09E-08 2.60E-07 Manganese -- -- -- 1.17E-07 1.28E-07 Nickel -- -- -- 4.18E-08 1.14E-06 Phosphorus -- -- -- 2.36E-07 1.77E-06 Selenium -- -- -- -- 3.62E-08 1. Footnotes taken from AP-42, Fifth Edition, Section 11.1, 03/04 and Section 11.12, 06/06. 2. Assumed to be equivalent to that of cement loading found in AP-42, Fifth Edition, Section 11.12, 06/06. 1. AP-42, Fifth Edition, Section 11.1, 03/04. Total (tpy) Operation Lime Silo Loading (Pneumatic) Asphalt Transport Asphalt Loadout Asphalt Silo Loading Fly Ash Silo Loading (Pneumatic) 3. AP-42, Fifth Edition, Section 11.12, 06/06, for controlled operations. 4. It is assumed that PM2.5 emission factors are equal to PM10 emission factors. Non-Metal HAPs Metal HAPs Kilgore Companies Benjamin Pit Page 15 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Table C-24. HAPs Emissions from Asphalt Operations HAP Asphalt Silo Loading (tpy) Asphalt Loadout (tpy) Asphalt Transport (tpy) Lime Silo Loading, Pneumatic (tpy) Lime Silo Loading, Pneumatic (tpy) Benzene 4.87E-04 2.70E-04 2.70E-04 0.00E+00 0.00E+00 Bromomethane 7.46E-05 4.99E-05 4.99E-05 0.00E+00 0.00E+00 Carbon Disulfide 2.44E-04 6.76E-05 6.76E-05 0.00E+00 0.00E+00 Chloroethane 6.09E-05 1.09E-06 1.09E-06 0.00E+00 0.00E+00 Chloromethane 3.50E-04 7.80E-05 7.80E-05 0.00E+00 0.00E+00 Cumene 0.00E+00 5.72E-04 5.72E-04 0.00E+00 0.00E+00 Ethylbenzene 5.79E-04 1.46E-03 1.46E-03 0.00E+00 0.00E+00 Formaldehyde 1.05E-02 4.57E-04 4.57E-04 0.00E+00 0.00E+00 Hexane 1.52E-03 7.80E-04 7.80E-04 0.00E+00 0.00E+00 Isooctane 4.72E-06 9.36E-06 9.36E-06 0.00E+00 0.00E+00 Methylene Chloride 4.11E-06 0.00E+00 0.00E+00 0.00E+00 0.00E+00 Naphthalene 5.78E-04 5.33E-04 5.33E-04 0.00E+00 0.00E+00 Phenol 0.00E+00 5.03E-04 5.03E-04 0.00E+00 0.00E+00 POM 3.04E-03 1.99E-03 1.99E-03 0.00E+00 0.00E+00 Styrene 8.23E-05 3.80E-05 3.80E-05 0.00E+00 0.00E+00 Tetrachloroethylene 0.00E+00 4.00E-05 4.00E-05 0.00E+00 0.00E+00 Toluene 9.44E-04 1.09E-03 1.09E-03 0.00E+00 0.00E+00 Xylene 3.91E-03 2.55E-03 2.55E-03 0.00E+00 0.00E+00 Arsenic 0.00E+00 0.00E+00 0.00E+00 1.56E-09 1.84E-07 Beryllium 0.00E+00 0.00E+00 0.00E+00 1.79E-10 1.66E-08 Cadmium 0.00E+00 0.00E+00 0.00E+00 1.72E-09 3.65E-09 Chromium 0.00E+00 0.00E+00 0.00E+00 1.07E-08 2.24E-07 Lead 0.00E+00 0.00E+00 0.00E+00 4.01E-09 9.56E-08 Manganese 0.00E+00 0.00E+00 0.00E+00 4.30E-08 4.70E-08 Nickel 0.00E+00 0.00E+00 0.00E+00 1.54E-08 4.19E-07 Phosphorus 0.00E+00 0.00E+00 0.00E+00 8.67E-08 6.50E-07 Selenium 0.00E+00 0.00E+00 0.00E+00 0.00E+00 1.33E-08 Max HAPs (tpy)1.05E-02 2.55E-03 2.55E-03 8.67E-08 6.50E-07 Total HAPs (tpy)2.24E-02 1.05E-02 1.05E-02 1.63E-07 1.65E-06 Metal HAPs Non-Metal HAPs Kilgore Companies Benjamin Pit Page 16 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Rating Max. Hourly Limit Fuel Usage (MMBtu/hr) (hr/yr/unit) (gal/yr) or (MMscf/yr) Hot Oil Heater 1 0.25 8,760 RFO 20,000 *Natural gas heating value per AP-42 Section 1.4:1,020 Btu/scf Table C-26. Criteria Pollutant Emission Factors Distillate/Diesel/No.2 Natural Gas RFO/Waste Oil/No.6 (lb/103 gal)1 (lb/106 scf)2 (lb/103 gal)1 PM10 2.40 7.6 3.42 PM2.5 2.14 7.6 2.21 NOX 20 50 55 CO 5.0 84 5 SO2 0.21 0.6 0.24 VOC 0.2 5.5 0.28 Table C-27. Criteria Pollutant Emissions (lb/hr) (lb/day) (tpy) PM10 7.81E-03 0.19 3.42E-02 PM2.5 5.05E-03 0.12 2.21E-02 NOX 1.26E-01 3.01 5.50E-01 CO 1.14E-02 0.27 5.00E-02 SO2 5.38E-04 1.29E-02 2.36E-03 VOC 6.39E-04 0.02 2.80E-03 2. AP-42, Fifth Edition, Section 1.4, 07/98. 1. AP-42, Fifth Edition, Section 1.3, 05/10. Pollutant Emissions from RFO Table C-25. Miscellaneous Combustion Equipment Type of Equipment Quantity Fuel Type Emission Factor Pollutant Kilgore Companies Benjamin Pit Page 17 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Table C-28. GHG Emission Factors Distillate/Diesel/No.2 Unit Natural Gas Unit RFO/Waste Oil/No.6 Unit CO2 73.96 (kg/MMBtu) 53.06 (kg/MMBtu) 75.10 (kg/MMBtu) N2O 6.00E-04 (kg/MMBtu) 1.00E-04 (kg/MMBtu) 6.00E-04 (kg/MMBtu) CH4 3.00E-03 (kg/MMBtu) 1.00E-03 (kg/MMBtu) 3.00E-03 (kg/MMBtu) CO2e 74.21 (kg/MMBtu) 53.11 (kg/MMBtu) 75.35 (kg/MMBtu) *NOTE: Hot oil heater is controlled with a low-NOX burner. Table C-29. GHG Emissions Emissions from RFO (tpy) CO2 181.30 N2O 1.45E-03 CH4 7.24E-03 CO2e 181.91 1. GHG emission factors from Tables C-1 and C-2, 40 CFR 98, Subpart C. CO2e is the cum of GHG constituents multiplied by their respective globabl warming potential (i.e., 1 for CO2, 25 for CH4, and 298 for N2O), per Table A-1, 40 CFR 98, Subpart A. GHG Pollutant GHG Pollutant Emission Factors1 Kilgore Companies Benjamin Pit Page 18 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Table C-30. HAPs Emission Factors1 Distillate/Diesel/No.22 Natural Gas RFO/Waste Oil/No.6 (lb/103 gal), (lb/1012 Btu)(lb/106 scf) (lb/10 3 gal) Benzene 2.14E-04 2.10E-03 2.14E-04 1,4-Dichlorobenzene(p)--1.20E-03 -- Ethylbenzene 6.36E-05 --6.36E-05 Formaldehyde 3.30E-02 7.50E-02 3.30E-02 Hexane --1.80E+00 -- Methyl Chloroform (1,1,1- Trichloroethane)2.36E-04 --2.36E-04 Naphthalene 1.13E-03 6.10E-04 1.13E-03 POM 6.06E-05 8.82E-05 6.06E-05 Toluene 6.20E-03 3.40E-03 6.20E-03 Xylene 1.09E-04 --1.09E-04 Antimony -- --5.25E-03 Arsenic 4 2.00E-04 1.32E-03 Beryllium 3 1.20E-05 2.78E-05 Cadmium 3 1.10E-03 3.98E-04 Chromium 3 1.40E-03 8.45E-04 Chromium IV -- --2.48E-04 Cobalt --8.40E-05 6.02E-03 Lead 9 5.00E-04 1.51E-03 Manganese 6 3.80E-04 3.00E-03 Mercury 3 2.60E-04 1.13E-04 Nickel 3 2.10E-03 8.45E-02 Phosphorus -- --9.46E-03 Selenium 15 2.40E-05 6.83E-04 Table C-31. HAPs Emissions Emissions from RFO (tpy) Benzene 2.14E-06 1,4-Dichlorobenzene(p)0.00E+00 Ethylbenzene 6.36E-07 Formaldehyde 3.30E-04 Hexane 0.00E+00 Methyl Chloroform (1,1,1- Trichloroethane)2.36E-06 Naphthalene 1.13E-05 POM 6.06E-07 Toluene 6.20E-05 Xylene 1.09E-06 Antimony 5.25E-05 Arsenic 1.32E-05 Beryllium 2.78E-07 Cadmium 3.98E-06 Chromium 8.45E-06 Chromium IV 2.48E-06 Cobalt 6.02E-05 Lead 1.51E-05 Manganese 3.00E-05 Mercury 1.13E-06 Nickel 8.45E-04 Phosphorus 9.46E-05 Selenium 6.83E-06 Table C-32. Fuel Heat Ratings Sulfur Content (% by weight) Distillate/Diesel/No. 2 0.14 (106 Btu/gal)0.0015 Natural Gas 1,020 (Btu/scf) 0.0015 RFO/Waste Oil/No. 6 0.15 (106 Btu/gal)0.0015 1. Per AP-42 Sections 1.3 (05/10) and 1.4 (07/98). Fuel Type Energy Factor1 Unit HAP HAP 2. The emission factors for non-metal HAPs resulting from distillate fuel oil combustion are given in pounds per thousand gallons, whereas the emission factors for metal HAPs resulting from distillate fuel oil combustion are given in pounds per 1012 British thermal units. 1. Emission factors for natural gas combustion from AP-42 Section 1.4, 07/98. Emission factors for distillate fuel oil and waste oil from AP-42 Section 1.3, 05/10. Kilgore Companies Benjamin Pit Page 19 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Tons of HMA Fuel Used Higher Heating Value RFO Higher Heating Value NG (tpy)(gal/yr) or (MMscf/yr)(MMBtu/gal) (MMBtu/MMScf) Drum-Mix Dryer 1 250,000 RFO 230,000 0.15 1,020 Table C-34. Criteria Pollutant Emission Factors RFO/Waste Oil/No.6 Natural Gas (lb/ton)(lb/ton) PM10 0.023 0.023 PM2.5 0.023 0.023 NOX 4 0.030 0.014 CO 0.13 0.13 SO2 0.058 0.0034 VOC 0.032 0.032 Table C-35. Criteria Pollutant Emissions (lb/hr) (lb/day)(tpy) PM10 0.66 15.75 2.88 PM2.5 0.66 15.75 2.88 NOX 0.86 20.72 3.78 CO 3.71 89.04 16.25 SO2 1.66 39.73 7.25 VOC 0.91 21.92 4.00 Table C-36. GHG Emission Factors Residual Fuel Oil No.6 Natural Gas (kg/mmBtu)(kg/mmBtu) CO2 75.1 53.06 N2O 6.00E-04 1.00E-04 CH4 3.00E-03 1.00E-03 CO2e 75.35 53.11 Table C-37. GHG Emissions Emissions from RFO (tpy) CO2 2,850.05 N2O 0.02 CH4 0.11 CO2e 2,859.68 RFO 1. GHG emission factors from Tables C-1 and C-2, 40 CFR 98, Subpart C. CO2e is the sum of GHG constituents multiplied by their respective global warming potential (i.e. 1 for CO2, 25 for CH4, and 298 for N2O), per Table A-1, 40 CFR 98, Subpart A. Pollutant GHG Pollutant GHG Pollutant Emissions from 3. Emission factors for VOC from AP-42 Section 11.1 Table 11.1-8. 2. Emission factors for CO, NOX, and SO2 from AP-42 Section 11.1 Table 11.1-7. 1. Emission factors for PM10 and PM2.5 from AP-42 Section 11.1 Table 11.1-3. PM2.5 estimated to be equal to PM10. Fuel type does not significantly affect PM emissions. Emission Factor1 Table C-33. Drum-Mix Asphalt Type of Equipment Quantity Pollutant Fuel Type Emission Factors1,2,3 4. Low NOX control of 45% reduction (average of 35% and 55%) has been applied per AP-42 Section 1.3.4.3. Kilgore Companies Benjamin Pit Page 20 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Table C-38. HAPs Emission Factors1,2 Waste oil Natural Gas (lb/ton) (lb/ton) Acetaldehyde 1.30E-03 0.00E+00 Acrolein 2.60E-05 0.00E+00 Benzene 3.90E-04 0.00039 Ethylbenzene 2.40E-04 0.00024 Formaldehyde 3.10E-03 0.0031 Hexane 9.20E-04 0.00092 Isooctane (2,2,4-trimethy 4.00E-05 4.00E-05 Methyl Ethyl Ketone 2.00E-05 0.00E+00 Propionaldehyde 1.30E-04 0.00E+00 Quinone 1.60E-04 0.00E+00 Methyl chloroform 4.80E-05 4.80E-05 Toluene 2.90E-03 0.00015 Xylene 2.00E-04 0.0002 2-Methylnaphthalene 1.70E-04 7.40E-05 Acenaphthene 1.40E-06 1.40E-06 Acenaphthylene 2.20E-05 8.60E-06 Anthracene 3.10E-06 2.20E-07 Benzo(a)anthracene 2.10E-07 2.10E-07 Benzo(a)pyrene 9.80E-09 9.80E-09 Benzo(b)fluoranthene 1.00E-07 1.00E-07 Benzo(e)pyrene 1.10E-07 1.10E-07 Benzo(g,h,i)perylene 4.00E-08 4.00E-08 Benzo(k)fluoranthene 4.10E-08 4.10E-08 Chrysene 1.80E-07 1.80E-07 Fluoranthene 6.10E-07 6.10E-07 Fluorene 1.10E-05 3.80E-06 Indeno(1,2,3-cd)pyrene 7.00E-09 7.00E-09 Naphthalene 6.50E-04 9.00E-05 Perylene 8.80E-09 8.80E-09 Phenanthrene 2.30E-05 7.60E-06 Pyrene 3.00E-06 5.40E-07 Dioxins 2.88E-09 0.00E+00 Furans 3.30E-09 0.00E+00 Arsenic 5.60E-07 5.60E-07 Beryllium 0.00E+00 0.00E+00 Cadmium 4.10E-07 4.10E-07 Chromium 5.50E-06 5.50E-06 Cobalt 2.60E-08 2.60E-08 Hexavalent Chromium 4.50E-07 4.50E-07 Lead 1.50E-05 6.20E-07 Manganese 7.70E-06 7.70E-06 Mercury 2.60E-06 2.40E-07 Nickel 6.30E-05 6.30E-05 Selenium 3.50E-07 3.50E-07 2. Heavy metal emission factors for waste oil-fired dryer with fabric filter from AP-42 Section 11.1 Table 11.1-12. 1. Emission factors for waste oil-fired and natural gas-fired dryers with fabric filters from AP-42 Section 11.1 Table 11.1-10. HAP Kilgore Companies Benjamin Pit Page 21 of 14 Trinity Consultants February 2022 Appendix B - Emissions Calculations Table C-39. HAPs Emissions HAP Emissions from RFO (tpy) Acetaldehyde 1.63E-01 Acrolein 3.25E-03 Benzene 4.88E-02 Ethylbenzene 3.00E-02 Formaldehyde 3.88E-01 Hexane 1.15E-01 Isooctane (2,2,4-trimethy 5.00E-03 Methyl Ethyl Ketone 2.50E-03 Propionaldehyde 1.63E-02 Quinone 2.00E-02 Methyl chloroform 6.00E-03 Toluene 3.63E-01 Xylene 2.50E-02 2-Methylnaphthalene 2.13E-02 Acenaphthene 1.75E-04 Acenaphthylene 2.75E-03 Anthracene 3.88E-04 Benzo(a)anthracene 2.63E-05 Benzo(a)pyrene 1.23E-06 Benzo(b)fluoranthene 1.25E-05 Benzo(e)pyrene 1.38E-05 Benzo(g,h,i)perylene 5.00E-06 Benzo(k)fluoranthene 5.13E-06 Chrysene 2.25E-05 Fluoranthene 7.63E-05 Fluorene 1.38E-03 Indeno(1,2,3-cd)pyrene 8.75E-07 Naphthalene 8.13E-02 Perylene 1.10E-06 Phenanthrene 2.88E-03 Pyrene 3.75E-04 Dioxins 3.60E-07 Furans 4.13E-07 Arsenic 7.00E-05 Beryllium 0.00E+00 Cadmium 5.13E-05 Chromium 6.88E-04 Hexavalent Chromium 5.63E-05 Cobalt 3.25E-06 Lead 1.88E-03 Manganese 9.63E-04 Mercury 3.25E-04 Nickel 7.88E-03 Selenium 4.38E-05 HAP Kilgore Companies Benjamin Pit Page 22 of 14 Trinity Consultants February 2022 Ap p e n d i x B - E m i s s i o n s C a l c u l a t i o n s Ta b l e C - 4 0 . B l a s t i n g a n d D r i l l i n g A r e a Ma x i m u m A n n u a l Bl a s t F r e q u e n c y (b l a s t s / y r ) Ma x i m u m A n n u a l Ar e a B l a s t e d (f t 2/y r ) Ma x i m u m D a i l y Bl a s t A r e a (f t 2/b l a s t ) Mi n i m u m D a i l y Bl a s t A r e a (f t 2/b l a s t ) 30 18 5 , 8 5 6 6 , 2 6 2 3 , 1 3 1 Ta b l e C - 4 1 . D r i l l i n g a n d B l a s t i n g E m i s s i o n F a c t o r s Va l u e U n i t s V a l u e U n i t s V a l u e U n i t s V a l u e U n i t s V a l u e U n i t s V a l u e U n i t s Bl a s t i n g AN F O 1 2 6 ( t p y ) 6 . 9 4 ( l b / b l a s t ) 3 . 6 1 ( l b / b l a s t ) 0 . 2 1 ( l b/ b l a s t ) 0 . 0 0 3 6 ( l b / t o n ) 1 . 8 0 ( l b / t o n ) 4 0 . 6 4 ( l b / t o n ) Dr i l l i n g An n u a l # o f D r i l l Ho l e s 4, 0 0 0 ( h o l e s / y r ) 1 . 3 0 ( l b / h o l e ) 0 . 6 8 ( l b / h o l e ) 3 . 9 0 E - 0 2 ( l b / h o l e ) - ( l b / t o n ) - ( l b / t o n ) - ( l b / t o n ) PM 10 : 0. 5 2 PM 2. 5 : 0. 0 3 PM 10 = P M 15 * 0 . 5 2 PM 2. 5 = T S P * 0 . 0 3 Ta b l e C - 4 2 . B l a s t i n g a n d D r i l l i n g E m i s s i o n s Co n t r o l E f f i c i e n c y 1 (% ) P M PM 10 PM 2. 5 SO 2 NO X CO P M PM 10 PM 2. 5 SO 2 NO X CO Bl a s t i n g 0 % 6 . 9 4 3 . 6 1 0 . 2 1 0 . 0 2 7 . 6 5 1 7 2 . 7 2 0 . 1 0 0 . 0 5 0 . 0 0 0 . 0 0 0 . 1 1 2 . 5 6 Dr i l l i n g 9 6 . 0 % 7 . 0 1 3 . 6 4 0 . 2 1 - - - - - - 0 . 1 0 0 . 0 5 3 . 1 2 E - 0 3 - - - - - - 13 . 9 5 7 . 2 5 0 . 4 2 0 . 0 2 7 . 6 5 1 7 2 . 7 2 0 . 2 1 0 . 1 1 0 . 0 1 0 . 0 0 0 . 1 1 2 . 5 6 2Da i l y B l a s t i n g P M E m i s s i o n s ( l b / d a y ) = E m i s s i o n F a c t o r ( l b s / d a y ) a s o n ly o n e b l a s t i s a l l o w e d p e r d a y . 3SO 2, N O X, & C O D a i l y B l a s t i n g E m i s s i o n s ( l b / d a y ) = E m i s s i o n F a c t o r ( l b / t o n) * A n n u a l A N F O T h r o u g h p u t ( t p y ) / A n n u a l B l a s t s ( b l a s t s / y r ) 4Da i l y P M D r i l l i n g E m i s s i o n s ( l b / d a y ) = E m i s s i o n F a c t o r (l b / h o l e ) * D r i l l H o l e s / y r / E x p e c t e d W o r k i n g D a y s / Y e a r 5SO 2, N O X, & C O A n n u a l B l a s t i n g E m i s s i o n s ( t p y ) = E m i s s i o n F a c t o r ( l b s / t o n ) * A n n u a l A N F O T h r o u g h p u t ( t p y ) * 1 t o n / 2 0 0 0 l b s 6An n u a l B l a s t i n g P M E m i s s i o n s ( t p y ) = E m i s s i o n Fa c t o r ( l b / b l a s t ) * b l a s t s / y r * 1 t o n / 2 0 0 0 l b s 7An n u a l P M D r i l l i n g E m i s s i o n s ( t p y ) = E m i s s i o n F a ct o r ( l b / h o l e ) * D r i l l H o l e s / y r * 1 t o n / 2 0 0 0 l b 6 Bl a s t a n d d r i l l i n g q u a n t i t i e s p r o v i d e d p e r d e s i g n b a s i s . 1Dr i l l i n g o p e r a t i o n s w i l l b e c o n t r o l l e d t h r o u g h w e t - d r i l l i n g . N I O S H r e p o r t s 9 6 % c o n t r o l e f f i c i e n c y f o r c o n t r o l l i n g f u g i t i v e e m i s si o n s v i a w e t - d r i l l i n g ( p e r N I O S H ' s D u s t C o n t r o l H a n d b o o k f o r I n d u s t r i a l M i n e r a l s M i n i n g an d P r o c e s s i n g , 2 0 1 2 ) . K i l g o r e c o n t r a c t s a d r i l l i n g c o m p a n y t h a t i m p l e m e n t s w e t - d r i l l i n g c o n t r o l t e c h n o l o g i e s t o r e d u c e f u g i t i v e d r i l l i n g e m i s s i o n s . Sc a l i n g f a c t o r s w e r e a p p l i e d t o P M 15 a n d T S P e m i s s i o n f a c t o r s t o c a l c u l a t e P M 10 a n d P M 2. 5 e m i s s i o n f a c t o r s r e s p e c t i v e l y p e r T a b l e 1 1 . 9 - 1 : As t h e r e i s n o t d a t a f o r t h e P M 15 e m i s s i o n f a c t o r e q u a t i o n , P M 15 i s c o n s e r v a t i v e l y a s s u m e d t o b e e q u a l t o T S P . 4 B l a s t i n g N O X a n d C O e m i s s i o n f a c t o r s r e t r i e v e d f r o m A N F O b l a s t i n g a g e n t f a c t o r f r o m A P - 4 2 1 3 . 3 - 1 . 3 Bl a s t i n g S O 2 e m i s s i o n f a c t o r d e v e l o p e d u s i n g a m a s s b a l a n c e a s s u m i n g 6 % f u e l o i l m i x t u r e w i t h 5 0 0 p p m s u l f u r c o n t e n t , c o n s i s t e n t w i t h E P A n on - r o a d s t a n d a r d s . S i n c e n o e m i s s i o n f a c t o r s a r e p r o v i d e d f o r P M 10 a n d P M 2. 5 d r i l l i n g o p e r a t i o n s , e m i s s i o n f a c t o r s w e r e c a l c u l a t e d u s i n g t h e P M 10 a n d P M 2. 5 t o T S P r a t i o s f o r b l a s t i n g o v e r b u r d e n p e r A P - 4 2 1 1 . 9 , T a b l e 1 1 . 9 - 1 , w h e r e : 2Dr i l l i n g P M e m i s s i o n f a c t o r i s r e t r i e v e d f r o m A P - 4 2 1 1 . 9 , T a b l e 11 . 9 - 4 , w h e r e t h e d r i l l i n g P M e m i s s i o n f a c t o r i s f o r o v e r b u r d e n m a t e r i a l f o r c o n s e r v a t i s m . T h e c o a l P M e m i s s i o n f a c t o r i s l o w e r a n d m a y b e a p p r o p r i a t e f o r s o m e d r i l l i n g op e r a t i o n s . To t a l A n n u a l E m i s s i o n s : So u r c e D e s c r i p t i o n An n u a l E m i s s i o n s ( t p y ) 5, 6 , 7 Ma x D a i l y E m i s s i o n s ( l b s / d a y ) 2, 3 , 6 0. 0 0 0 0 1 4 ( A ) ^ 1 . 5 A = h o r i z o n t a l a r e a ( f t 2࢏࡫ ˁ ǫ ʋ Ǡ Ź ȍ Ŕ ɽ ʋ ǫ ȥ ǌ Ǝ ơ ɢ ʋ Ǡ औ ࠆ ߿ ǉ ʋ 1Bl a s t i n g P M e m i s s i o n f a c t o r s r e t r i e v e d f r o m A P - 4 2 1 1 . 9 , T a b l e 1 1 . 9- 1 . U s i n g t h e e q u a t i o n b e l o w t h e h o r i z o n t a l a r e a b l a s t e d ( A ) is a s s u m e d t o b e t h e a v e r a g e d a i l y B l a s t A r e a . SO 2 So u r c e A c t i v i t y T h r o u g h p u t So u r c e D e s c r i p t i o n U n i t s Em i s s i o n F a c t o r 1, 2 , 3 , 4 , 5 , 6 PM 10 PM 2. 5 NO X CO PM Ki l g o r e C o m p a n i e s Be n j a m i n P i t Pa g e 2 3 o f 1 4 Tr i n i t y C o n s u l t a n t s Fe b r u a r y 2 0 2 2 .LOJRUH&RPSDQLHV%HQMDPLQ_1RWLFHRI,QWHQW& (&2120,&)($6,%,/,7<$1$/<6,6 Appendix C: Economic Feasibility Analysis BACT CONTROL COST EVALUATION Technology:Vapor Recovery Unit Application:Storage Tank Operations Pollutants:Volatile Organic Compounds (VOCs) Vapor Recovery Unit Each Storage Tank Notes Process Information Uncontrolled Emissions (tpy)5.30E-02 Calculated Controlled Emissions (tpy) 2.65E-03 BACT references require 95% control. Labor Costs Operator ($/hour)15.00$ Standard assumption Supervisor ($/hour)20.00$ Standard assumption Maintenance ($/hour)20.00$ Standard assumption Economic Factors Dollar Inflation (2009 to 2021) 1.3164 U.S. Consumer Price Index Equipment Life Expectancy (Years) 30 Conservatively assumed to be equivalent to standard EPA guidance. Interest Rate (%) 7.00% Current Avg SBA Loan Rate Capital Recovery Factor (CRF)0.0806 Calculated DIRECT COSTS Notes Purchased Equipment Costs Total Equipment Cost and Installation1 63,144 A Instrumentation 6,314 0.10 × A Sales Tax 3,789 0.06 × A Freight 3,157 0.05 × A Total Purchased Equipment Costs 76,404 B = 1.18 × A Total Capital Investment ($) 76,404 TCI = B + C + D ANNUAL COSTS Notes Direct Annual Costs 2 Operating Labor (0.5 hr, per 8-hr shift) 8,213 E Supervisory Labor (15% operating labor) 1,232 F = 0.15 × E Maintenance Labor (0.5 hr, per 8-hr shift) 10,950 G Maintenance Materials 382 H = 0.005 x TCI Total Direct Annual Costs 20,776 DAC = E +F+ G+ H+ J Indirect Annual Costs 3 Overhead 12,466 N = 0.60 × (E + F + G + H) Administrative Charges 1,528 O = 0.02 × TCI Property Tax 764 P = 0.01 × TCI Insurance 764 Q = 0.01 × TCI Capital Recovery4 6,157 R Total Indirect Annual Costs 21,679 IDAC = N+O+P+Q+R Total Annual Cost ($) 42,456 TAC = DAC + IDAC Pollutant Removed (tpy) 5.03E-02 Cost per ton of Pollutant Removed ($) 843,848 $/ton = TAC / Pollutant Removed 1. US EPA estimate per "Installing Vapor Recovery Units: Lessons Learned from the Natural Gas STAR Program", August 31, 2009. 4. Capital Recovery factor calculated based on Equation 2.8a (Section 1, Chapter 2, page 2-21) and Table 1.13 (Section 2, Chapter 1, page 1-52) of U.S. EPA OAQPS, EPA Air Pollution Control Cost Manual (6th Edition), January 2002. Key Assumptions Capital Cost Operating Cost 2. U.S. EPA OAQPS, EPA Air Pollution Control Cost Manual (6th Edition), January 2002, Section 3.2, Chapter 2, Table 2.8 (assumed to be equivalent to catalytic incineration). 3. U.S. EPA OAQPS, EPA Air Pollution Control Cost Manual (6th Edition), January 2002, Section 3.2, Chapter 2, Table 2.10 (assumed to be equivalent to catalytic incineration). Kilgore Benjamin NOI Air Permit Application 1 of 1 Trinity Consultants February 2022