The URL can be used to link to this page

Home My WebLink AboutDAQ-2024-008202 DAQE-AN147800003-24 {{$d1 }} Jim Davidson United States Bakery dba Franz Bakery, Salt Lake City 315 NE 10th Avenue Portland, OR 97232 Jim.Davidson@usbakery.com Dear Mr. Davidson: Re: Approval Order: Modification to Approval Order DAQE-AN147800002-20 for an Increase in Production of Bread and Buns Project Number: N147800003 The attached Approval Order (AO) is issued pursuant to the Notice of Intent (NOI) received on August 10, 2023. United States Bakery dba Franz Bakery, Salt Lake City must comply with the requirements of this AO, all applicable state requirements (R307), and Federal Standards. The project engineer for this action is John Persons, who can be contacted at (385) 306-6503 or jpersons@utah.gov. Future correspondence on this AO should include the engineer's name as well as the DAQE number shown on the upper right-hand corner of this letter. No public comments were received on this action. Sincerely, {{$s }} Bryce C. Bird Director BCB:JP:jg cc: Salt Lake County Health Department 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 536-4414 www.deq.utah.gov Printed on 100% recycled paper State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director May 28, 2024 STATE OF UTAH Department of Environmental Quality Division of Air Quality {{#s=Sig_es_:signer1:signature}} {{#d1=date1_es_:signer1:date:format(date, "mmmm d, yyyy")}} {{#d2=date1_es_:signer1:date:format(date, "mmmm d, yyyy"):align(center)}} APPROVAL ORDER DAQE-AN147800003-24 Modification to Approval Order DAQE-AN147800002-20 for an Increase in Production of Br ead and Buns Prepared By John Persons, Engineer (385) 306-6503 jpersons@utah.gov Issued to United States Bakery Issued On {{$d2 }} Issued By {{$s }} Bryce C. Bird Director Division of Air Quality May 28, 2024 TABLE OF CONTENTS TITLE/SIGNATURE PAGE ....................................................................................................... 1 GENERAL INFORMATION ...................................................................................................... 3 CONTACT/LOCATION INFORMATION ............................................................................... 3 SOURCE INFORMATION ........................................................................................................ 3 General Description ................................................................................................................ 3 NSR Classification .................................................................................................................. 3 Source Classification .............................................................................................................. 3 Applicable Federal Standards ................................................................................................. 3 Project Description.................................................................................................................. 3 SUMMARY OF EMISSIONS .................................................................................................... 4 SECTION I: GENERAL PROVISIONS .................................................................................... 4 SECTION II: PERMITTED EQUIPMENT .............................................................................. 5 SECTION II: SPECIAL PROVISIONS ..................................................................................... 5 PERMIT HISTORY ..................................................................................................................... 7 ACRONYMS ................................................................................................................................. 8 DAQE-AN147800003-24 Page 3 GENERAL INFORMATION CONTACT/LOCATION INFORMATION Owner Name Source Name United States Bakery dba Franz Bakery, Salt Lake City United States Bakery Mailing Address Physical Address 315 NE 10th Avenue 8556 South 2940 West Portland, OR 97232 West Jordan, UT 84088 Source Contact UTM Coordinates Name: Jim Davidson 418,501 m Easting Phone: (503) 232-2191 Ext 4228 4,494,291 m Northing Email: Jim.Davidson@usbakery.com Datum NAD83 UTM Zone 12 SIC code 2051 (Bread & Other Bakery Products, Except Cookies & Crackers) SOURCE INFORMATION General Description United States Bakery (USB), dba Franz Bakery, Salt Lake City, operates a bakery to make bread, buns, cookies, muffins, and donuts. Dry or moist ingredients are mixed, divided, rounded, molded, and proofed. The ingredients are then baked or fried. Emissions include natural gas combustion from boilers, ovens, fryers, deep frying operations, material loading/unloading and mixing, and yeast fermentation processes. NSR Classification Minor Modification at Minor Source Source Classification Located in Northern Wasatch Front O3 NAA, Salt Lake City UT PM2.5 NAA, Salt Lake County SO2 NAA Salt Lake County Airs Source Size: B Applicable Federal Standards None Project Description USB has requested to modify its current AO (DAQE-AN147800002-20) for its West Jordan Bakery to increase the production of bread and buns. USB has requested to increase its annual production of bread by 1,340 tpy and buns by 2,010 tpy. This change increases the VOC PTEs by 7.96 tpy. DAQE-AN147800003-24 Page 4 SUMMARY OF EMISSIONS The emissions listed below are an estimate of the total potential emissions from the source. Some rounding of emissions is possible. Criteria Pollutant Change (TPY) Total (TPY) CO2 Equivalent 0 9404.00 Carbon Monoxide 0 5.77 Nitrogen Oxides 0 6.87 Particulate Matter - PM10 0.01 1.09 Particulate Matter - PM2.5 0.01 1.09 Sulfur Dioxide 0 0.04 Volatile Organic Compounds 7.96 49.50 Hazardous Air Pollutant Change (lbs/yr) Total (lbs/yr) Generic HAPs (CAS #GHAPS) 0 260 Change (TPY) Total (TPY) Total HAPs 0 0.13 SECTION I: GENERAL PROVISIONS I.1 All definitions, terms, abbreviations, and references used in this AO conform to those used in the UAC R307 and 40 CFR. Unless noted otherwise, references cited in these AO conditions refer to those rules. [R307-101] I.2 The limits set forth in this AO shall not be exceeded without prior approval. [R307-401] I.3 Modifications to the equipment or processes approved by this AO that could affect the emissions covered by this AO must be reviewed and approved. [R307-401-1] I.4 All records referenced in this AO or in other applicable rules, which are required to be kept by the owner/operator, shall be made available to the Director or Director's representative upon request, and the records shall include the two-year period prior to the date of the request. Unless otherwise specified in this AO or in other applicable state and federal rules, records shall be kept for a minimum of two (2) years. [R307-401-8] I.5 At all times, including periods of startup, shutdown, and malfunction, owners and operators shall, to the extent practicable, maintain and operate any equipment approved under this AO, including associated air pollution control equipment, in a manner consistent with good air pollution control practice for minimizing emissions. Determination of whether acceptable operating and maintenance procedures are being used will be based on information available to the Director which may include, but is not limited to, monitoring results, opacity observations, review of operating and maintenance procedures, and inspection of the source. All maintenance performed on equipment authorized by this AO shall be recorded. [R307-401-4] I.6 The owner/operator shall comply with UAC R307-107. General Requirements: Breakdowns. [R307-107] I.7 The owner/operator shall comply with UAC R307-150 Series. Emission Inventories. [R307-150] DAQE-AN147800003-24 Page 5 SECTION II: PERMITTED EQUIPMENT II.A THE APPROVED EQUIPMENT II.A.1 United States Bakery Bakery II.A.2 Miscellaneous Natural Gas Combustion Equipment Including boilers, ovens, and fryers Each equipment is rated less than 5 MMBtu/hr; Total rated capacity is 21 MMBtu/hr or less II.A.3 Three (3) Mixers Venting to the inside of building Listed for information only II.A.4 Three (3) Flour Silos Each is rated at 50 tons or less Emissions from the silos are controlled with a baghouse SECTION II: SPECIAL PROVISIONS II.B REQUIREMENTS AND LIMITATIONS II.B.1 Source-Wide Requirements II.B.1.a The owner/operator shall control emissions from the flour silos with a baghouse during loading/unloading operations. [R307-401-8] II.B.1.b The owner/operator shall not allow visible emissions from any emission unit on site to exceed 10% opacity. [R307-401-8] II.B.1.b.1 Opacity observations of emissions from stationary sources shall be conducted according to 40 CFR 60, Appendix A, Method 9. [R307-401-8] II.B.2 Oven and Proof Box Requirements II.B.2.a The owner/operator shall inspect ovens and proof boxes weekly and remove dough and bread by scraping and sweeping, as needed. [R307-401-8] II.B.2.a.1 The owner/operator shall: A. Record the date and time the ovens and proof boxes were inspected each week and whether they were scrapped and swept. B. Keep the inspection, scrapping, and sweeping records onsite at all times the facility is in operation. [R307-401-8] II.B.2.b The owner/operator shall inspect the interior and exterior of ovens and proof boxes monthly and remove oil, bread, dough, and other accumulated waste, as needed. [R307-401-8] DAQE-AN147800003-24 Page 6 II.B.2.b.1 The owner/operator shall: A. Record the date and time of inspection and whether the oil, bread, dough, and other accumulated waste were removed. B. Keep the records onsite at all times the facility is in operation. [R307-401-8] II.B.3 VOC Limit II.B.3.a The owner/operator shall not emit more than 49.50 tons of VOC per rolling 12-month period from its operations. [R307-401-8] II.B.3.a.1 Compliance with the limitation shall be determined on a rolling 12-month total. No later than 28 days after the end of each month, a new 12-month total shall be calculated using data from previous 12 months. [R307-401-8] II.B.3.a.2 VOC emissions from yeast-raised bread baking operations shall be calculated using the following formula: VOC emissions = (Daily tons of baked products) (VOC emission factor)/2000 Where: VOC emissions in tons per day Daily tons of baked products include bread, buns, and donuts VOC emission factor in lbs of VOC per ton of baked products. [R307-401-8] II.B.3.a.3 VOC emission factor from yeast-raised bread baking operations shall be calculated using the following formula: VOC emission factor = 0.95Yi + 0.195ti - 0.51S - 0.86ts + 1.90 Where: VOC emission factor in lbs of VOC per ton of baked products Yi = initial baker's percent of yeast ti = total yeast action time in hours S = final (spike) baker's percent of yeast, and ts = spiking time in hours. [R307-401-8] II.B.3.a.4 The owner/operator shall maintain daily records of the above parameters used to calculate the VOC emissions and VOC emission factor. The records of baked products shall include bread, buns, and donuts and shall be determined by sales records. All the records shall be kept on a daily basis. [R307-401-8] DAQE-AN147800003-24 Page 7 PERMIT HISTORY This Approval Order shall supersede (if a modification) or will be based on the following documents: Supersedes AO DAQE-AN147800002-20 dated December 10, 2020 Is Derived From NOI dated August 10, 2023 Incorporates Additional Information dated October 30, 2023 DAQE-AN147800003-24 Page 8 ACRONYMS The following lists commonly used acronyms and associated translations as they apply to this document: 40 CFR Title 40 of the Code of Federal Regulations AO Approval Order BACT Best Available Control Technology CAA Clean Air Act CAAA Clean Air Act Amendments CDS Classification Data System (used by Environmental Protection Agency to classify sources by size/type) CEM Continuous emissions monitor CEMS Continuous emissions monitoring system CFR Code of Federal Regulations CMS Continuous monitoring system CO Carbon monoxide CO2 Carbon Dioxide CO2e Carbon Dioxide Equivalent - Title 40 of the Code of Federal Regulations Part 98, Subpart A, Table A-1 COM Continuous opacity monitor DAQ/UDAQ Division of Air Quality DAQE This is a document tracking code for internal Division of Air Quality use EPA Environmental Protection Agency FDCP Fugitive dust control plan GHG Greenhouse Gas(es) - Title 40 of the Code of Federal Regulations 52.21 (b)(49)(i) GWP Global Warming Potential - Title 40 of the Code of Federal Regulations Part 86.1818- 12(a) HAP or HAPs Hazardous air pollutant(s) ITA Intent to Approve LB/YR Pounds per year MACT Maximum Achievable Control Technology MMBTU Million British Thermal Units NAA Nonattainment Area NAAQS National Ambient Air Quality Standards NESHAP National Emission Standards for Hazardous Air Pollutants NOI Notice of Intent NOx Oxides of nitrogen NSPS New Source Performance Standard NSR New Source Review PM10 Particulate matter less than 10 microns in size PM2.5 Particulate matter less than 2.5 microns in size PSD Prevention of Significant Deterioration PTE Potential to Emit R307 Rules Series 307 R307-401 Rules Series 307 - Section 401 SO2 Sulfur dioxide Title IV Title IV of the Clean Air Act Title V Title V of the Clean Air Act TPY Tons per year UAC Utah Administrative Code VOC Volatile organic compounds DAQE-IN147800003-24 April 17, 2024 Jim Davidson United States Bakery dba Franz Bakery, Salt Lake City 315 NE 10th Avenue Portland, OR 97232 Jim.Davidson@usbakery.com Dear Mr. Davidson: Re: Intent to Approve: Modification to Approval Order DAQE-AN147800002-20 for an Increase in Production of Bread and Buns Project Number: N147800003 The attached document is the Intent to Approve (ITA) for the above-referenced project. The ITA is subject to public review. Any comments received shall be considered before an Approval Order (AO) is issued. The Division of Air Quality is authorized to charge a fee for reimbursement of the actual costs incurred in the issuance of an AO. An invoice will follow upon issuance of the final AO. Future correspondence on this ITA should include the engineer's name, John Persons, as well as the DAQE number as shown on the upper right-hand corner of this letter. John Persons, can be reached at (385) 306-6503 or jpersons@utah.gov, if you have any questions. Sincerely, {{$s }} Jon L. Black, Manager New Source Review Section JLB:JP:jg cc: Salt Lake County Health Department 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 536-4414 www.deq.utah.gov Printed on 100% recycled paper State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director * ) ' & — + - @ E v A ? A C @ C w C E ˜ STATE OF UTAH Department of Environmental Quality Division of Air Quality INTENT TO APPROVE DAQE-IN147800003-24 Modification to Approval Order DAQE-AN147800002-20 for an Increase in Production of Bread and Buns Prepared By John Persons, Engineer (385) 306-6503 jpersons@utah.gov Issued to United States Bakery Issued On April 17, 2024 {{$s }} New Source Review Section Manager Jon L. Black {{#s=Sig_es_:signer1:signature}} * ) ' & — + - @ E v A ? A C @ C w C E ˜ TABLE OF CONTENTS TITLE/SIGNATURE PAGE ....................................................................................................... 1 GENERAL INFORMATION ...................................................................................................... 3 CONTACT/LOCATION INFORMATION ............................................................................... 3 SOURCE INFORMATION ........................................................................................................ 3 General Description ................................................................................................................ 3 NSR Classification .................................................................................................................. 3 Source Classification .............................................................................................................. 3 Applicable Federal Standards ................................................................................................. 3 Project Description.................................................................................................................. 3 SUMMARY OF EMISSIONS .................................................................................................... 4 PUBLIC NOTICE STATEMENT............................................................................................... 4 SECTION I: GENERAL PROVISIONS .................................................................................... 4 SECTION II: PERMITTED EQUIPMENT .............................................................................. 5 SECTION II: SPECIAL PROVISIONS ..................................................................................... 6 PERMIT HISTORY ..................................................................................................................... 7 ACRONYMS ................................................................................................................................. 8 DAQE-IN147800003-24 Page 3 GENERAL INFORMATION CONTACT/LOCATION INFORMATION Owner Name Source Name United States Bakery dba Franz Bakery, Salt Lake City United States Bakery Mailing Address Physical Address 315 NE 10th Avenue 8556 South 2940 West Portland, OR 97232 West Jordan, UT 84088 Source Contact UTM Coordinates Name: Jim Davidson 418,501 m Easting Phone: (503) 232-2191 Ext 4228 4,494,291 m Northing Email: Jim.Davidson@usbakery.com Datum NAD83 UTM Zone 12 SIC code 2051 (Bread & Other Bakery Products, Except Cookies & Crackers) SOURCE INFORMATION General Description United States Bakery (USB), dba Franz Bakery, Salt Lake City, operates a bakery to make bread, buns, cookies, muffins, and donuts. Dry or moist ingredients are mixed, divided, rounded, molded, and proofed. The ingredients are then baked or fried. Emissions include natural gas combustion from boilers, ovens, fryers, deep frying operations, material loading/unloading and mixing, and yeast fermentation processes. NSR Classification Minor Modification at Minor Source Source Classification Located in Northern Wasatch Front O3 NAA, Salt Lake City UT PM2.5 NAA, Salt Lake County SO2 NAA Salt Lake County Airs Source Size: B Applicable Federal Standards None Project Description USB has requested to modify its current AO (DAQE-AN147800002-20) for its West Jordan Bakery to increase the production of bread and buns. USB has requested to increase its annual production of bread by 1,340 tpy and buns by 2,010 tpy. This change increases the VOC PTEs by 7.96 tpy. DAQE-IN147800003-24 Page 4 SUMMARY OF EMISSIONS The emissions listed below are an estimate of the total potential emissions from the source. Some rounding of emissions is possible. Criteria Pollutant Change (TPY) Total (TPY) CO2 Equivalent 0 9404.00 Carbon Monoxide 0 5.77 Nitrogen Oxides 0 6.87 Particulate Matter - PM10 0.01 1.09 Particulate Matter - PM2.5 0.01 1.09 Sulfur Dioxide 0 0.04 Volatile Organic Compounds 7.96 49.50 Hazardous Air Pollutant Change (lbs/yr) Total (lbs/yr) Generic HAPs (CAS #GHAPS) 0 260 Change (TPY) Total (TPY) Total HAPs 0 0.13 PUBLIC NOTICE STATEMENT The NOI for the above-referenced project has been evaluated and has been found to be consistent with the requirements of UAC R307. Air pollution producing sources and/or their air control facilities may not be constructed, installed, established, or modified prior to the issuance of an AO by the Director. A 30-day public comment period will be held in accordance with UAC R307-401-7. A notification of the intent to approve will be published in the Salt Lake Tribune and Deseret News on April 21, 2024. During the public comment period the proposal and the evaluation of its impact on air quality will be available for the public to review and provide comment. If anyone so requests a public hearing within 15 days of publication, it will be held in accordance with UAC R307-401-7. The hearing will be held as close as practicable to the location of the source. Any comments received during the public comment period and the hearing will be evaluated. The proposed conditions of the AO may be changed as a result of the comments received. SECTION I: GENERAL PROVISIONS The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. I.1 All definitions, terms, abbreviations, and references used in this AO conform to those used in the UAC R307 and 40 CFR. Unless noted otherwise, references cited in these AO conditions refer to those rules. [R307-101] I.2 The limits set forth in this AO shall not be exceeded without prior approval. [R307-401] DAQE-IN147800003-24 Page 5 I.3 Modifications to the equipment or processes approved by this AO that could affect the emissions covered by this AO must be reviewed and approved. [R307-401-1] I.4 All records referenced in this AO or in other applicable rules, which are required to be kept by the owner/operator, shall be made available to the Director or Director's representative upon request, and the records shall include the two-year period prior to the date of the request. Unless otherwise specified in this AO or in other applicable state and federal rules, records shall be kept for a minimum of two (2) years. [R307-401-8] I.5 At all times, including periods of startup, shutdown, and malfunction, owners and operators shall, to the extent practicable, maintain and operate any equipment approved under this AO, including associated air pollution control equipment, in a manner consistent with good air pollution control practice for minimizing emissions. Determination of whether acceptable operating and maintenance procedures are being used will be based on information available to the Director which may include, but is not limited to, monitoring results, opacity observations, review of operating and maintenance procedures, and inspection of the source. All maintenance performed on equipment authorized by this AO shall be recorded. [R307-401-4] I.6 The owner/operator shall comply with UAC R307-107. General Requirements: Breakdowns. [R307-107] I.7 The owner/operator shall comply with UAC R307-150 Series. Emission Inventories. [R307-150] SECTION II: PERMITTED EQUIPMENT The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. II.A THE APPROVED EQUIPMENT II.A.1 United States Bakery Bakery II.A.2 Miscellaneous Natural Gas Combustion Equipment Including boilers, ovens, and fryers. Each equipment is rated less than 5 MMBtu/hr; Total rated capacity is 21 MMBtu/hr or less II.A.3 Three (3) Mixers Venting to the inside of building Listed for information only II.A.4 Three (3) Flour Silos Each is rated at 50 tons or less Emissions from the silos are controlled with a baghouse DAQE-IN147800003-24 Page 6 SECTION II: SPECIAL PROVISIONS The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. II.B REQUIREMENTS AND LIMITATIONS II.B.1 Source-Wide Requirements II.B.1.a The owner/operator shall control emissions from the flour silos with a baghouse during loading/unloading operations. [R307-401-8] II.B.1.b The owner/operator shall not allow visible emissions from any emission unit on site to exceed 10% opacity. [R307-401-8] II.B.1.b.1 Opacity observations of emissions from stationary sources shall be conducted according to 40 CFR 60, Appendix A, Method 9. [R307-401-8] II.B.2 Oven and Proof Box Requirements II.B.2.a The owner/operator shall inspect ovens and proof boxes weekly and remove dough and bread by scraping and sweeping, as needed. [R307-401-8] II.B.2.a.1 The owner/operator shall: A. Record the date and time the ovens and proof boxes were inspected each week and whether they were scrapped and swept. B. Keep the inspection, scrapping, and sweeping records onsite at all times the facility is in operation. [R307-401-8] II.B.2.b The owner/operator shall inspect the interior and exterior of ovens and proof boxes monthly and remove oil, bread, dough, and other accumulated waste, as needed. [R307-401-8] II.B.2.b.1 The owner/operator shall: A. Record the date and time of inspection and whether the oil, bread, dough, and other accumulated waste was removed. B. Keep the records onsite at all times the facility is in operation. [R307-401-8] II.B.3 VOC Limit II.B.3.a The owner/operator shall not emit more than 49.50 tons of VOC per rolling 12-month period from its operations. [R307-401-8] II.B.3.a.1 Compliance with the limitation shall be determined on a rolling 12-month total. No later than 28 days after the end of each month a new 12-month total shall be calculated using data from previous 12 months. [R307-401-8] DAQE-IN147800003-24 Page 7 II.B.3.a.2 VOC emissions from yeast-raised bread baking operations shall be calculated using the following formula: VOC emissions = (Daily tons of baked products)(VOC emission factor)/2000 Where: VOC emissions in tons per day Daily tons of baked products include bread, buns, and donuts VOC emission factor in lbs of VOC per ton of baked products. [R307-401-8] II.B.3.a.3 VOC emission factor from yeast-raised bread baking operations shall be calculated using the following formula: VOC emission factor = 0.95Yi + 0.195ti - 0.51S - 0.86ts + 1.90 Where: VOC emission factor in lbs of VOC per ton of baked products Yi = initial baker's percent of yeast ti = total yeast action time in hours S = final (spike) baker's percent of yeast, and ts = spiking time in hours. [R307-401-8] II.B.3.a.4 The owner/operator shall maintain daily records of the above parameters used to calculate the VOC emissions and VOC emission factor. The records of baked products shall include bread, buns and donuts and shall be determined by sales records. All the records shall be kept on a daily basis. [R307-401-8] PERMIT HISTORY This Approval Order shall supersede (if a modification) or will be based on the following documents: Supersedes AO DAQE-AN147800002-20 dated December 10, 2020 Is Derived From NOI dated August 10, 2023 Incorporates Additional Information dated October 30, 2023 DAQE-IN147800003-24 Page 8 ACRONYMS The following lists commonly used acronyms and associated translations as they apply to this document: 40 CFR Title 40 of the Code of Federal Regulations AO Approval Order BACT Best Available Control Technology CAA Clean Air Act CAAA Clean Air Act Amendments CDS Classification Data System (used by Environmental Protection Agency to classify sources by size/type) CEM Continuous emissions monitor CEMS Continuous emissions monitoring system CFR Code of Federal Regulations CMS Continuous monitoring system CO Carbon monoxide CO2 Carbon Dioxide CO2e Carbon Dioxide Equivalent - Title 40 of the Code of Federal Regulations Part 98, Subpart A, Table A-1 COM Continuous opacity monitor DAQ/UDAQ Division of Air Quality DAQE This is a document tracking code for internal Division of Air Quality use EPA Environmental Protection Agency FDCP Fugitive dust control plan GHG Greenhouse Gas(es) - Title 40 of the Code of Federal Regulations 52.21 (b)(49)(i) GWP Global Warming Potential - Title 40 of the Code of Federal Regulations Part 86.1818- 12(a) HAP or HAPs Hazardous air pollutant(s) ITA Intent to Approve LB/YR Pounds per year MACT Maximum Achievable Control Technology MMBTU Million British Thermal Units NAA Nonattainment Area NAAQS National Ambient Air Quality Standards NESHAP National Emission Standards for Hazardous Air Pollutants NOI Notice of Intent NOx Oxides of nitrogen NSPS New Source Performance Standard NSR New Source Review PM10 Particulate matter less than 10 microns in size PM2.5 Particulate matter less than 2.5 microns in size PSD Prevention of Significant Deterioration PTE Potential to Emit R307 Rules Series 307 R307-401 Rules Series 307 - Section 401 SO2 Sulfur dioxide Title IV Title IV of the Clean Air Act Title V Title V of the Clean Air Act TPY Tons per year UAC Utah Administrative Code VOC Volatile organic compounds DAQE-NN147800003-24 April 17, 2024 Salt Lake Tribune and Deseret News Legal Advertising Dept. P.O. Box 704055 West Valley City, UT 84170 Acct #9001399880 RE: Legal Notice of Intent to Approve This letter will confirm the authorization to publish the attached NOTICE in the Salt Lake Tribune and Deseret News on April 21, 2024. Please mail the invoice and affidavit of publication to the Utah State Department of Environmental Quality, Division of Air Quality, P.O. Box 144820, Salt Lake City, Utah 84114-4820. If you have any questions, contact Jeree Greenwood, who may be reached at (385) 306-6514. Sincerely, {{$s }} Jeree Greenwood Office Technician Enclosure cc: Wasatch Front Regional Council cc: Salt Lake County 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 903-3978 www.deq.utah.gov Printed on 100% recycled paper State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director DAQE-NN147800003-24 Page 2 NOTICE A Notice of Intent for the following project submitted in accordance with R307-401-1, Utah Administrative Code (UAC), has been received for consideration by the Director: Company Name: United States Bakery dba Franz Bakery, Salt Lake City Location: United States Bakery – 8556 South 2940 West, West Jordan, UT Project Description: United States Bakery (USB), dba Franz Bakery, Salt Lake City, operates a bakery to make bread, buns, cookies, muffins, and donuts. Dry or moist ingredients are mixed, divided, rounded, molded, and proofed. The ingredients are then baked or fried. Emissions include natural gas combustion from boilers, ovens, and fryers, deep frying operations, material loading/unloading and mixing, and yeast fermentation processes. USB has requested to increase its annual production of bread by 1,340 tpy and buns by 2,010 tpy. This change increases the Volatile organic compounds Potential to emits by 7.96 tpy. The completed engineering evaluation and air quality impact analysis showed the proposed project meets the requirements of federal air quality regulations and the State air quality rules. The Director intends to issue an Approval Order pending a 30-day public comment period. The project proposal, estimate of the effect on local air quality and draft Approval Order are available for public inspection and comment at the Utah Division of Air Quality, 195 North 1950 West, Salt Lake City, UT 84116. Written comments received by the Division at this same address on or before May 21, 2024 will be considered in making the final decision on the approval/disapproval of the proposed project. Email comments will also be accepted at jpersons@utah.gov. If anyone so requests to the Director in writing within 15 days of publication of this notice, a hearing will be held in accordance with R307-401-7, UAC. Under Section 19-1-301.5, a person who wishes to challenge a Permit Order may only raise an issue or argument during an adjudicatory proceeding that was raised during the public comment period and was supported with sufficient information or documentation to enable the Director to fully consider the substance and significance of the issue. Date of Notice: April 21, 2024 {{#s=Sig_es_:signer1:signature}} The Salt Lake Tribune Publication Name: The Salt Lake Tribune Publication URL: Publication City and State: Salt Lake City, UT Publication County: Salt Lake Notice Popular Keyword Category: Notice Keywords: united states bakery Notice Authentication Number: 202404231057063842947 1761527914 Notice URL: Back Notice Publish Date: Sunday, April 21, 2024 Notice Content NOTICE A Notice of Intent for the following project submitted in accordance with R307-401-1, Utah Administrative Code (UAC), has been received for consideration by the Director: Company Name: United States Bakery dba Franz Bakery, Salt Lake City Location: United States Bakery – 8556 South 2940 West, West Jordan, UT Project Description: United States Bakery (USB), dba Franz Bakery, Salt Lake City, operates a bakery to make bread, buns, cookies, muffins, and donuts. Dry or moist ingredients are mixed, divided, rounded, molded, and proofed. The ingredients are then baked or fried. Emissions include natural gas combustion from boilers, ovens, and fryers, deep frying operations, material loading/unloading and mixing, and yeast fermentation processes. USB has requested to increase its annual production of bread by 1,340 tpy and buns by 2,010 tpy. This change increases the Volatile organic compounds Potential to emits by 7.96 tpy. The completed engineering evaluation and air quality impact analysis showed the proposed project meets the requirements of federal air quality regulations and the State air quality rules. The Director intends to issue an Approval Order pending a 30-day public comment period. The project proposal, estimate of the effect on local air quality and draft Approval Order are available for public inspection and comment at the Utah Division of Air Quality, 195 North 1950 West, Salt Lake City, UT 84116. Written comments received by the Division at this same address on or before May 21, 2024 will be considered in making the final decision on the approval/disapproval of the proposed project. Email comments will also be accepted at jpersons@utah.gov. If anyone so requests to the Director in writing within 15 days of publication of this notice, a hearing will be held in accordance with R307-401-7, UAC. Under Section 19-1-301.5, a person who wishes to challenge a Permit Order may only raise an issue or argument during an adjudicatory proceeding that was raised during the public comment period and was supported with sufficient information or documentation to enable the Director to fully consider the substance and significance of the issue. Date of Notice: April 21, 2024 SLT0027170 Back 4/23/24, 9:57 AM utahlegals.com/(S(t2y53uyuspim5ppapnfwtpur))/DetailsPrint.aspx?SID=t2y53uyuspim5ppapnfwtpur&ID=183217 https://www.utahlegals.com/(S(t2y53uyuspim5ppapnfwtpur))/DetailsPrint.aspx?SID=t2y53uyuspim5ppapnfwtpur&ID=183217 1/1 DAQE- RN147800003 January 29, 2024 Jim Davidson United States Bakery dba Franz Bakery, Salt Lake City 315 NE 10th Avenue Portland, OR 97232 Jim.Davidson@usbakery.com Dear Jim Davidson, Re: Engineer Review: Modification to AO DAQE-AN147800002-20 for an Increase in Production of Bread and Buns Project Number: N147800003 The DAQ requests a company representative review and sign the attached Engineer Review (ER). This ER identifies all applicable elements of the New Source Review permitting program. United States Bakery dba Franz Bakery, Salt Lake City should complete this review within 10 business days of receipt. United States Bakery dba Franz Bakery, Salt Lake City should contact John Persons at (385) 306-6503 if there are questions or concerns with the review of the draft permit conditions. Upon resolution of your concerns, please email John Persons at jpersons@utah.gov the signed cover letter. Upon receipt of the signed cover letter, the DAQ will prepare an ITA for a 30-day public comment period. At the completion of the comment period, the DAQ will address any comments and will prepare an Approval Order (AO) for signature by the DAQ Director. If United States Bakery dba Franz Bakery, Salt Lake City does not respond to this letter within 10 business days, the project will move forward without source concurrence. If United States Bakery dba Franz Bakery, Salt Lake City has concerns that cannot be resolved and the project becomes stagnant, the DAQ Director may issue an Order prohibiting construction. Approval Signature _____________________________________________________________ (Signature & Date) 195 North 1950 West • Salt Lake City, UT Mailing Address: P.O. Box 144820 • Salt Lake City, UT 84114-4820 Telephone (801) 536-4000 • Fax (801) 536-4099 • T.D.D. (801) 903-3978 www.deq.utah.gov Printed on 100% recycled paper Department of Environmental Quality Kimberly D. Shelley Executive Director DIVISION OF AIR QUALITY Bryce C. Bird Director State of Utah SPENCER J. COX Governor DEIDRE HENDERSON Lieutenant Governor Engineer Review N147800003: United States Bakery January 29, 2024 Page 1 UTAH DIVISION OF AIR QUALITY ENGINEER REVIEW SOURCE INFORMATION Project Number N147800003 Owner Name United States Bakery dba Franz Bakery, Salt Lake City Mailing Address 315 NE 10th Avenue Portland, OR, 97232 Source Name United States Bakery Source Location 8556 South 2940 West West Jordan, UT 84088 UTM Projection 418,501 m Easting, 4,494,291 m Northing UTM Datum NAD83 UTM Zone UTM Zone 12 SIC Code 2051 (Bread & Other Bakery Products, Except Cookies & Crackers) Source Contact Jim Davidson Phone Number (503) 813-0382 Email Jim.Davidson@usbakery.com Billing Contact Jim Davidson Phone Number (503) 813-0382 Email Jim.Davidson@usbakery.com Project Engineer John Persons, Engineer Phone Number (385) 306-6503 Email jpersons@utah.gov Notice of Intent (NOI) Submitted August 10, 2023 Date of Accepted Application October 30, 2023 Engineer Review N147800003: United States Bakery January 29, 2024 Page 2 SOURCE DESCRIPTION General Description United States Bakery (USB), dba Franz Bakery, Salt Lake City, operates a bakery to make bread, buns, cookies, muffins, and donuts. Dry or moist ingredients are mixed, divided, and rounded. molded, and proofed. The ingredients are then baked or fried. Emissions include natural gas combustion from boilers, ovens, fryers, deep frying operations, material loading/unloading and mixing, and yeast fermentation processes. NSR Classification: Minor Modification at Minor Source Source Classification Located in , Southern Wasatch Front O3 NAA, Salt Lake City UT PM2.5 NAA, Salt Lake County SO2 NAA, Salt Lake County Airs Source Size: B Applicable Federal Standards None Project Proposal Modification to AO DAQE-AN147800002-20 for an Increase in Production of Bread and Buns Project Description United States Bakery (USB) has requested to modify its current AO (DAQE-AN147800002-20) for its West Jordan Bakery to increase the production of bread and buns. USB has requested to increase its annual production of bread by 1,340 tpy and buns by 2,010 tpy. This change increases the VOC PTEs by 7.96 tpy. EMISSION IMPACT ANALYSIS The emission increases in criteria pollutants and HAPs from this modification are less than the modeling threshold values listed in R307-410; therefore, modeling is not required for this modification. [Last updated January 9, 2024] Engineer Review N147800003: United States Bakery January 29, 2024 Page 3 SUMMARY OF EMISSIONS The emissions listed below are an estimate of the total potential emissions from the source. Some rounding of emissions is possible. Criteria Pollutant Change (TPY) Total (TPY) CO2 Equivalent 0 9404.00 Carbon Monoxide 0 5.77 Nitrogen Oxides 0 6.87 Particulate Matter - PM10 0.01 1.09 Particulate Matter - PM2.5 0.01 1.09 Sulfur Dioxide 0 0.04 Volatile Organic Compounds 7.96 49.50 Hazardous Air Pollutant Change (lbs/yr) Total (lbs/yr) Generic HAPs (CAS #GHAPS) 0 260 Change (TPY) Total (TPY) Total HAPs 0 0.13 Note: Change in emissions indicates the difference between previous AO and proposed modification. Engineer Review N147800003: United States Bakery January 29, 2024 Page 4 Review of BACT for New/Modified Emission Units 1. BACT review regarding VOC emission from Yeast Production United States Bakery (USB) has requested to increase its bread and bun production at its West Jordan Bakery. This change will result in an increase in VOCs and trace amounts of PM10 and PM2.5. These emissions increases will result from two things: Yeast Development and Mixers/Silos. These two sources of pollution will be analyzed below. Yeast Production The Yeast Production process has the potential to emit VOCs. USB researched various control technologies that could be used to control these emissions. These technologies include carbon adsorption, catalytic oxidizers, condensation units, thermal oxidizers, proper cleaning operation, and wet-packed-bed scrubbers. The use of carbon adsorption is technically infeasible because oils and fats emitted from ovens and fryers will clog the pores of the activated carbon, which reduces the life of the system and also makes the system significantly less efficient. The use of condensation units is technically infeasible because of the bakery ovens' high airflow rates. Based on research of similar sources condensation has not proven to be feasible for controlling VOCs from bakery ovens. The use of wet-packed-bed scrubbers is not technically feasible because installing wet-packed-bed scrubbers would require the source to further install a wastewater treatment plant of an ethanol recovery unit. Even though this might technically be feasible there is no chance that implementation of this would prove to be cost- effective because the only emissions that could be used in the cost feasibility equation are the increase in VOCs. The use of catalytic oxidizers, thermal oxidizers, and proper cleaning operations are all technically feasible. List of remaining control technologies listed by control efficiently (1 - most efficient): Catalytic Oxidizer (95-99%) Thermal Oxidizer (95%) Proper Cleaning Operations The use of catalytic oxidizers is economically infeasible. Based on manufacturers' costs collected by USB it would cost $44,193 per ton of VOCs removed. The use of thermal oxidizers is economically infeasible. Based on manufacturers' costs collected by USB it would cost $34,562 per ton of VOCs removed. The use of proper cleaning operations is economically feasible. Proper cleaning operations includes weekly removal of dough/bread from ovens and proof boxes by scraping and sweeping. It also includes monthly removal of oil, dough, bread, and other accumulated waste from the interior and exterior of the ovens and proof boxes. The DAQ selects the following BACT: The owner/operator shall operate the ovens and proof boxes according to the proper cleaning operational guidelines. Proper cleaning operations includes weekly removal of dough/bread from ovens and proof boxes by scraping and sweeping. It also includes monthly removal of oil, dough, bread, and other accumulated waste from the interior and exterior of the ovens and proof boxes [Last updated January 29, 2024] 2. BACT review regarding PM emissions from mixers and silos This modification will increase PM10 and PM2.5 emissions from the mixers and silos onsite. The PM10 and PM2.5 will both increase by 0.01 tpy. This increase is trivial and no further emissions control technologies exist that would be cost-effective based on the minimal emissions increase. Engineer Review N147800003: United States Bakery January 29, 2024 Page 5 The DAQ requires no further control technologies. [Last updated January 9, 2024] SECTION I: GENERAL PROVISIONS The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. (New or Modified conditions are indicated as “New” in the Outline Label): I.1 All definitions, terms, abbreviations, and references used in this AO conform to those used in the UAC R307 and 40 CFR. Unless noted otherwise, references cited in these AO conditions refer to those rules. [R307-101] I.2 The limits set forth in this AO shall not be exceeded without prior approval. [R307-401] I.3 Modifications to the equipment or processes approved by this AO that could affect the emissions covered by this AO must be reviewed and approved. [R307-401-1] I.4 All records referenced in this AO or in other applicable rules, which are required to be kept by the owner/operator, shall be made available to the Director or Director's representative upon request, and the records shall include the two-year period prior to the date of the request. Unless otherwise specified in this AO or in other applicable state and federal rules, records shall be kept for a minimum of two (2) years. [R307-401-8] I.5 At all times, including periods of startup, shutdown, and malfunction, owners and operators shall, to the extent practicable, maintain and operate any equipment approved under this AO, including associated air pollution control equipment, in a manner consistent with good air pollution control practice for minimizing emissions. Determination of whether acceptable operating and maintenance procedures are being used will be based on information available to the Director which may include, but is not limited to, monitoring results, opacity observations, review of operating and maintenance procedures, and inspection of the source. All maintenance performed on equipment authorized by this AO shall be recorded. [R307- 401-4] I.6 The owner/operator shall comply with UAC R307-107. General Requirements: Breakdowns. [R307-107] I.7 The owner/operator shall comply with UAC R307-150 Series. Emission Inventories. [R307- 150] SECTION II: PERMITTED EQUIPMENT The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. (New or Modified conditions are indicated as “New” in the Outline Label): Engineer Review N147800003: United States Bakery January 29, 2024 Page 6 II.A THE APPROVED EQUIPMENT II.A.1 United States Bakery Bakery II.A.2 Misc. Natural Gas Combustion Equipment Including boilers, ovens, and fryers. Each equipment is rated less than 5 MMBtu/hr; Total rated capacity is 21 MMBtu/hr or less II.A.3 Three (3) Mixers Venting to the inside of building Listed for information only II.A.4 Three (3) Flour Silos Each is rated at 50 tons or less Emissions from the silos are controlled with a baghouse SECTION II: SPECIAL PROVISIONS The intent is to issue an air quality AO authorizing the project with the following recommended conditions and that failure to comply with any of the conditions may constitute a violation of the AO. (New or Modified conditions are indicated as “New” in the Outline Label): II.B REQUIREMENTS AND LIMITATIONS II.B.1 Source-Wide Requirements II.B.1.a The owner/operator shall control emissions from the flour silos with a baghouse during loading/unloading operations. [R307-401-8] II.B.1.b The owner/operator shall not allow visible emissions from any emission unit on site to exceed 10% opacity. [R307-401-8] II.B.1.b.1 Opacity observations of emissions from stationary sources shall be conducted according to 40 CFR 60, Appendix A, Method 9. [R307-401-8] II.B.2 NEW Oven and Proof Box Requirements II.B.2.a NEW The owner/operator shall remove dough and bread from ovens and proof boxes by scraping and sweeping weekly. [R307-401-8] II.B NEW The owner/operator shall remove oil, bread, dough, and other accumulated waste from the interior and exterior of ovens and proof boxes monthly. [R307-401-8] II.B.1 VOC Limit Engineer Review N147800003: United States Bakery January 29, 2024 Page 7 II.B.1.a NEW The owner/operator shall not allow VOC emissions from yeast-raised bread baking operations to exceed 49.50 tons per rolling 12-month period. [R307-401-8] II.B.1.a.1 Compliance with the limitation shall be determined on a rolling 12-month total. No later than 28 days after the end of each month a new 12-month total shall be calculated using data from previous 12 months. [R307-401-8] II.B.1.a.2 VOC emissions from yeast-raised bread baking operations shall be calculated using the following formula: VOC emissions = (Daily tons of baked products)(VOC emission factor)/2000 Where: VOC emissions in tons per day Daily tons of baked products include bread, buns, and donuts VOC emission factor in lbs of VOC per ton of baked products. [R307-401-8] II.B.1.a.3 VOC emission factor from yeast-raised bread baking operations shall be calculated using the following formula: VOC emission factor = 0.95Yi + 0.195ti - 0.51S - 0.86ts + 1.90 Where: VOC emission factor in lbs of VOC per ton of baked products Yi = initial baker's percent of yeast ti = total yeast action time in hours S = final (spike) baker's percent of yeast, and ts = spiking time in hours. [R307-401-8] II.B.1.a.4 The owner/operator shall maintain daily records of the above parameters used to calculate the VOC emissions and VOC emission factor. The records of baked products shall include bread, buns and donuts and shall be determined by sales records. All the records shall be kept on a daily basis. [R307-401-8] Engineer Review N147800003: United States Bakery January 29, 2024 Page 8 PERMIT HISTORY When issued, the approval order shall supersede (if a modification) or will be based on the following documents: Supersedes AO DAQE-AN147800002-20 dated December 10, 2020 Is Derived From NOI dated August 10, 2023 Incorporates Additional Information dated October 30, 2023 REVIEWER COMMENTS 1. Comment regarding Production Increases: United States Bakery has requested to increase its annual production of bread by 1,340 tpy and buns by 2,010 tpy at its West Jordan Bakery. This change increases the VOC PTEs by 7.96 tpy. There are no limits in the permit specifically limiting the tpy of bread and bun production, instead, the DAQ is using a VOC limit to ensure compliance with production throughputs. [Last updated January 9, 2024] 2. Comment regarding emission calculations: Particulate and VOC emission factors for deep frying operations are obtained from AP-42 Chapter 9, Table 9.13.3-2&3. PM2.5 emissions are conservatively assumed to be the same as PM10. Emissions are calculated using the dough through-put multiplied by the emission factors. Particulate emissions from silo loading/unloading emissions are calculated using emission factors in AP-42 Chapter 11.12-2 for cement supplement to elevated storage silos. Emissions from the loading/unloading operations are controlled with a baghouse. VOC emissions from fermentation are divided in four (4) production lines. Emission factors are obtained from the Alternative Control Technology Document for Bakery Oven Emissions (EPA 453/R-92-017, December 1992). [Last updated January 9, 2024] 3. Comment regarding NSPS and MACT : Non-Applicability of 40 CFR 60 (NSPS) Subpart DC and 40 CFR 63 (MACT) Subpart JJJJJJ. 40 CFR 60 Subpart Dc applies to each steam generating unit for which construction, modification, or reconstruction is commenced after June 9, 1989 and that has a maximum design heat input capacity of 29 megawatts (MW) (100 million British thermal units per hour (MMBtu/h)) or less, but greater than or equal to 2.9 MW (10 MMBtu/h). All the natural gas-fired equipment at this facility is rated at less than 5 MMBtu/hr; therefore, Subpart Dc does not apply to any natural gas combustion equipment on site. 40 CFR 63 Subpart JJJJJJ applies to the boilers located at an area source of HAPs. However, this subpart does not apply to boilers that only burn natural gas as fuel. The emergency boiler at this facility burns only natural gas as fuel and therefore, it is not subject to Subpart JJJJJJ. [Last updated January 9, 2024] Engineer Review N147800003: United States Bakery January 29, 2024 Page 9 4. Comment regarding Title V Applicability : Title V of the 1990 Clean Air Act (Title V) applies to the following: 1. Any major source 2. Any source subject to a standard, limitation, or other requirement under Section 111 of the Act, Standards of Performance for New Stationary Sources; 3. Any source subject to a standard or other requirement under Section 112 of the Act, Hazardous Air Pollutants. 4. Any Title IV affected source. This source is not a major source, not subject to any federal standard, and not a Title IV-affected source. Therefore, Title V does not apply to the source. [Last updated January 9, 2024] Engineer Review N147800003: United States Bakery January 29, 2024 Page 10 ACRONYMS The following lists commonly used acronyms and associated translations as they apply to this document: 40 CFR Title 40 of the Code of Federal Regulations AO Approval Order BACT Best Available Control Technology CAA Clean Air Act CAAA Clean Air Act Amendments CDS Classification Data System (used by EPA to classify sources by size/type) CEM Continuous emissions monitor CEMS Continuous emissions monitoring system CFR Code of Federal Regulations CMS Continuous monitoring system CO Carbon monoxide CO2 Carbon Dioxide CO2e Carbon Dioxide Equivalent - 40 CFR Part 98, Subpart A, Table A-1 COM Continuous opacity monitor DAQ/UDAQ Division of Air Quality DAQE This is a document tracking code for internal UDAQ use EPA Environmental Protection Agency FDCP Fugitive dust control plan GHG Greenhouse Gas(es) - 40 CFR 52.21 (b)(49)(i) GWP Global Warming Potential - 40 CFR Part 86.1818-12(a) HAP or HAPs Hazardous air pollutant(s) ITA Intent to Approve LB/HR Pounds per hour LB/YR Pounds per year MACT Maximum Achievable Control Technology MMBTU Million British Thermal Units NAA Nonattainment Area NAAQS National Ambient Air Quality Standards NESHAP National Emission Standards for Hazardous Air Pollutants NOI Notice of Intent NOx Oxides of nitrogen NSPS New Source Performance Standard NSR New Source Review PM10 Particulate matter less than 10 microns in size PM2.5 Particulate matter less than 2.5 microns in size PSD Prevention of Significant Deterioration PTE Potential to Emit R307 Rules Series 307 R307-401 Rules Series 307 - Section 401 SO2 Sulfur dioxide Title IV Title IV of the Clean Air Act Title V Title V of the Clean Air Act TPY Tons per year UAC Utah Administrative Code VOC Volatile organic compounds 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHUL 7ULQLW\&RQVXOWDQWV 87$+',9,6,212)$,548$/,7<±127,&(2),17(17 0RGLILFDWLRQRI'$4($1 8QLWHG6WDWHV%DNHU\±:HVW-RUGDQ8WDK 3UHSDUHG%\ 75,1,7<&2168/7$176 :DVDWFK%RXOHYDUG 6XLWH 6DOW/DNH&LW\87 $XJXVW 3URMHFW 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWVLL 7$%/(2)&217(176 (;&(&87,9(6800$5< *(1(5$/,1)250$7,21 'HVFULSWLRQRI)DFLOLW\ $WWDLQPHQW6WDWXV 6RXUFH6L]H'HWHUPLQDWLRQ )HHV )RUPV '(6&5,37,212)352-(&7$1'352&(66 'HVFULSWLRQRI3URMHFW 'HVFULSWLRQRI3URFHVV %UHDG3URGXFWLRQ %XQ3URGXFWLRQ 3URFHVV)ORZ'LDJUDPV (0,66,2165(/$7(',1)250$7,21 <HDVW'HYHORSPHQW 0DWHULDO+DQGOLQJ /RDGLQJ8QORDGLQJ$FWLYLWLHV 0L[LQJ 6RXUFH6L]H'HWHUPLQDWLRQ %(67$9$,/$%/(&21752/7(&+12/2*<$1$/<6,6 <HDVW'HYHORSPHQW <HDVW'HYHORSPHQW92&%$&7 0L[HUVDQG6LORV 0L[HUVDQG6LORV30DQG30%$&7 (0,66,21,03$&7$1$/<6,6 &RPSDULVRQWR0RGHOLQJ7KUHVKROGV 121$77$,10(170$,17(1$1&($5($62))6(77,1* $33/,&$%/(5(*8/$7,216 *HQHUDO,QWURGXFWLRQ±8WDK5HJXODWLRQV 8$&5*HQHUDO5HTXLUHPHQWV%UHDNGRZQV 8$&5 8$&56ROYHQW&OHDQLQJ 8$&51RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDVIRU30(PLVVLRQ6WDQGDUGV 8$&51RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDVIRU30DQG30)XJLWLYH (PLVVLRQVDQG)XJLWLYH'XVW 8$&52]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV*HQHUDO5HTXLUHPHQWV 8$&5$SSURYDO2UGHU 8$&53HUPLWV)HHVIRU$SSURYDO2UGHUV )HGHUDO5HJXODWLRQV $33(1',;$)2506$ $33(1',;%(0,66,216&$/&8/$7,216 % $33(1',;&%$&7(&2120,&$1$/<6,6 & 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV (;&(&87,9(6800$5< 7KLV1RWLFHRI,QWHQW12,LVEHLQJVXEPLWWHGWRWKH8WDK'LYLVLRQRI$LU4XDOLW\8'$4E\7ULQLW\ &RQVXOWDQWV7ULQLW\RQEHKDOIRI8QLWHG6WDWHV%DNHU\86%GED)UDQ])DPLO\%DNHULHVWRPRGLI\86%¶V :HVW-RUGDQ8WDK%DNHU\WKH8WDK%DNHU\ORFDWHGDW6RXWK:HVW:HVW-RUGDQ8WDK 7KH8WDK%DNHU\RSHUDWHVXQGHU$SSURYDO2UGHU$2'$4($1LVVXHG'HFHPEHU E\8'$47KHSXUSRVHRIWKLV12,DLUSHUPLWDSSOLFDWLRQLVWRLQFUHDVHDQQXDOWKURXJKSXWVRIEUHDGDQG EXQVDWWKH8WDK%DNHU\ 7KH8WDK%DNHU\XWLOL]HVPL[HUVSURRIER[HVRYHQVDQGIU\HUVWRSURGXFHDQDVVRUWPHQWRIEDNHG SURGXFWV7KHDQQXDOLQFUHDVHLQWKURXJKSXWVDVVRFLDWHGZLWKWKLVSURMHFWLVWRQVSHU\HDUWS\RI EUHDGDQGWS\RIEXQV7KLVZLOOUHVXOWLQWKHIROORZLQJSURGXFWLRQOLPLWVIRUEUHDGDQGEXQVDWWKH 8WDK%DNHU\UHVSHFWLYHO\WS\DQGWS\7KLVLQFUHDVHLQWKURXJKSXWZLOOUHVXOWLQDQLQFUHDVHLQ HPLVVLRQVJHQHUDWHGE\PDWHULDOKDQGOLQJRSHUDWLRQVHJVLORORDGLQJRIUDZPDWHULDOVORDGLQJDQG XQORDGLQJDQGPL[LQJRSHUDWLRQVDQGGRXJKUDLVLQJHPLVVLRQV &ULWHULDSROOXWDQWVWKDWZLOOH[SHULHQFHDQLQFUHDVHLQHPLVVLRQVXQGHUWKLVSURMHFWDUHSDUWLFXODWHPDWWHU 30ZLWKDQDHURG\QDPLFGLDPHWHURIPLFURQVRUOHVV3030ZLWKDQDHURG\QDPLFGLDPHWHURI PLFURQV30DQG9RODWLOH2UJDQLF&RPSRXQGV92&V7KHLQFUHDVHLQSRWHQWLDOWRHPLW37(ZLOOEHDV IROORZV30 WS\30 WS\DQG92&V WS\$VDOORWKHUHTXLSPHQWDWWKH8WDK%DNHU\ KDVSUHYLRXVO\EHHQSHUPLWWHGDWKRXUVSHU\HDUQRLQFUHDVHLQRWKHUFULWHULDSROOXWDQWVZLOORFFXU XQGHUWKLVSURMHFW 7KLV12,DLUSHUPLWDSSOLFDWLRQKDVEHHQGHYHORSHGSXUVXDQWWR8$&5DQG8WDK¶V12,DLUSHUPLW DSSOLFDWLRQJXLGDQFH,WLQFOXGHVUHTXLUHGVXSSRUWLQJLQIRUPDWLRQIRUWKHPRGLILFDWLRQVVSHFLILHGDERYH QDPHO\ ჭ12,)RUPVDQG)HHV ჭ3URFHVV'HVFULSWLRQ ჭ6LWH3ODQ ჭ3RWHQWLDO(PLVVLRQ&DOFXODWLRQV ჭ%HVW$YDLODEOH&RQWURO7HFKQRORJ\%$&7$QDO\VLV ჭ$SSOLFDEOH5HJXODWRU\5HTXLUHPHQWVDQG ჭ(PLVVLRQ,PSDFW$QDO\VLV 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV *(1(5$/,1)250$7,21 7KHIROORZLQJVHFWLRQFRQWDLQVWKHLQIRUPDWLRQUHTXHVWHGXQGHUWKH³6RXUFH,GHQWLILFDWLRQ,QIRUPDWLRQ´ VHFWLRQRI8'$4)RUP1RWLFHRI,QWHQW12,$SSOLFDWLRQ&KHFNOLVW 'HVFULSWLRQRI)DFLOLW\ ჭ&RPSDQ\1DPH 8QLWHG6WDWHV%DNHU\GED)UDQ])DPLO\%DNHULHV ჭ$GGUHVV 6RXWK:HVW:HVW-RUGDQ87 ჭ&RXQW\ 6DOW/DNH&RXQW\ ჭ870&RRUGLQDWHV (DVWLQJP1RUWKLQJP=RQH ჭ3ULPDU\6,&&RGH %UHDG 2WKHU%DNHU\3URGXFWV([FHSW&RRNLHV &UDFNHUV ჭ$GGLWLRQDO6,&&RGH &RRNLHVDQG&UDFNHUV $OOFRUUHVSRQGHQFHUHJDUGLQJWKLVVXEPLVVLRQVKRXOGEHDGGUHVVHGWR ჭ0U-LP'DYLGVRQ ჭ&RUSRUDWH(QYLURQPHQWDO+HDOWK 6DIHW\0DQDJHU ჭ2IILFH3KRQHH[W ჭ0RELOH3KRQH ჭ(PDLO-LP'DYLGVRQ#XVEDNHU\FRP ჭ0U0LFDK6WHYHQV ჭ2SHUDWLRQV0DQDJHU ჭ2IILFH3KRQH ჭ0RELOH3KRQH ჭ(PDLO0LFDK6WHYHQV#XVEDNHU\FRP $WWDLQPHQW6WDWXV 7KH8WDK%DNHU\LVORFDWHGZLWKLQDQDUHDRI6DOW/DNH&RXQW\WKDWLVFODVVLILHGDVDWWDLQPHQWIRUDOO SROOXWDQWVZLWKH[FHSWLRQWRWKHIROORZLQJ30IRUZKLFKLWLVFODVVLILHGDVDVHULRXVQRQDWWDLQPHQW DUHDRIWKHKRXU1$$46IRUWKHKRXU2]RQH6WDQGDUGZKLFKLVGHVLJQDWHGDVPRGHUDWH QRQDWWDLQPHQWDQGDPDUJLQDOQRQDWWDLQPHQWDUHDRI627KH30QRQDWWDLQPHQWDUHDZDV UHGHVLJQDWHGDVDWWDLQPHQWE\WKH(3$HIIHFWLYHDVRI0DUFK 6RXUFH6L]H'HWHUPLQDWLRQ 7KH8WDK%DNHU\¶V37(LVOHVVWKDQPDMRUVRXUFHWKUHVKROGVDVGHVFULEHGLQWKHIROORZLQJ12,DLUSHUPLW DSSOLFDWLRQDQGLVWKHUHIRUHVXEMHFWWRPLQRU1HZ6RXUFH5HYLHZ165 ჭ3UHFXUVRUVWR30QLWURJHQR[LGHV>12[@6292&DQGDPPRQLD>1+@DUHOHVVWKDQWS\ ჭ12;DQG92&VDUHOHVVWKDQKRXUR]RQHPRGHUDWHQRQDWWDLQPHQWWKUHVKROGVRIWS\HDFK ჭ30DQGFDUERQPRQR[LGH&2DUHOHVVWKDQWS\DVWKH8WDK%DNHU\LVQRWDOLVWHGVRXUFHDQG ჭ,QGLYLGXDOKD]DUGRXVDLUSROOXWDQWV+$3VDQGDJJUHJDWH+$3VDUHEHORZDQGWS\UHVSHFWLYHO\ 7KHUHIRUHWKH8WDK%DNHU\ZLOOFRQWLQXHWREHFODVVLILHGDVDPLQRUVRXUFH %DVHGRQUHSRUWIURP8'$4RQ-XO\KWWSVGHTXWDKJRYDLUTXDOLW\R]RQHRYHUYLHZDQGVWDQGDUGPRGHUDWHDUHD R]RQHVLS 7KH8WDK%DNHU\LVORFDWHGLQDQDUHDWKDWLVFODVVLILHGDVVHULRXVQRQDWWDLQPHQWIRU30DQGLWVSUHFXUVRUV$VDUHVXOW PDMRUVRXUFHWKUHVKROGVDUHWS\ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV )LJXUH26LWH/RFDWLRQ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV )HHV 86%ZLOOXVHWKH8'$4¶V3D\PHQW3RUWDOWRSUHSD\WKHIROORZLQJ8'$412,DLUSHUPLWDSSOLFDWLRQIHHV DVVRFLDWHGZLWKWKLVVXEPLWWDO ჭ³$SSOLFDWLRQ)LOLQJ)HH´IRUWKH³1HZ0LQRU6RXUFHRU0LQRU0RGLILFDWLRQDW0LQRURU0DMRU6RXUFH´ FDWHJRU\ ჭ³$SSOLFDWLRQ5HYLHZ)HH´IRUWKH³1HZ0LQRU6RXUFHRU0LQRU0RGLILFDWLRQDW0LQRURU0DMRU6RXUFH´ FDWHJRU\LQPDLQWHQDQFHRUQRQDWWDLQPHQWDUHDV ჭ7RWDO8'$4IHHV 86%XQGHUVWDQGVWKDWWKHWRWDOSHUPLWUHYLHZIHHLVEDVHGRQWKHWRWDODFWXDOWLPHVSHQWE\8'$4VWDII SURFHVVLQJWKLV12,DLUSHUPLWDSSOLFDWLRQDQGWKDWLIWKHWRWDOUHYLHZWLPHLVPRUHWKDQVWDQGDUGKRXUV 8'$4ZLOOLQYRLFH86%DWSHUKRXUIRUWKHDGGLWLRQDOWLPHDERYHVWDQGDUGKRXUV )RUPV 7KHIROORZLQJ8'$4IRUPVDUHLQFOXGHGLQ$SSHQGL[$WRWKLVDSSOLFDWLRQ ჭ)RUP1RWLFHRI,QWHQW$SSOLFDWLRQ ჭ)RUP&RPSDQ\,QIRUPDWLRQ ჭ)RUP3URFHVV,QIRUPDWLRQ ჭ)RUP3URMHFW,QIRUPDWLRQ ჭ)RUP(PLVVLRQV,QIRUPDWLRQ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV '(6&5,37,212)352-(&7$1'352&(66 'HVFULSWLRQRI3URMHFW 86%SURSRVHVWRLQFUHDVHEUHDGDQGEXQSURGXFWLRQE\WS\DQGWS\UHVSHFWLYHO\WKLVZLOOUHVXOW LQDWRWDOSRWHQWLDODQQXDOWKURXJKSXWRIWS\DQGWS\UHVSHFWLYHO\7KHLQFUHDVHLQWKURXJKSXW ZLOOUHVXOWLQDQLQFUHDVHLQSRWHQWLDOHPLVVLRQVWKURXJKGRXJKUDLVLQJ\HDVWGHYHORSPHQWDQGPDWHULDO KDQGOLQJDWWKHVLORVDQGPL[HUV7KLVSURMHFWLQFOXGHVRQO\DQLQFUHDVHLQWKURXJKSXWVDQGDVVRFLDWHG SRWHQWLDOHPLVVLRQVQRHTXLSPHQWZLOOEHDGGHGRUPRGLILHGDWWKH8WDK%DNHU\$VDOOQDWXUDOJDV FRPEXVWLRQHTXLSPHQWDWWKH8WDK%DNHU\LVDOUHDG\SHUPLWWHGDWKRXUVSHU\HDUQRLQFUHDVHLQ SRWHQWLDOHPLVVLRQVZLOOUHVXOWIURPWKRVHXQLWVXQGHUWKLVSURMHFW$OOLQFUHDVHGSRWHQWLDOHPLVVLRQV DVVRFLDWHGZLWKWKLVSURMHFWXSGDWHFRPHIURPLQFUHDVHG\HDVWGHYHORSPHQWDQGLWVDVVRFLDWHGRSHUDWLRQV HJPL[LQJ 'HVFULSWLRQRI3URFHVV 7KLVVHFWLRQFRQWDLQVWKHLQIRUPDWLRQUHTXLUHGE\8'$4)RUP5DDQGH %UHDG3URGXFWLRQ 86%XVHVDVWUDLJKWGRXJKSURFHVVWRPDNHEUHDGLQZKLFKDOOLQJUHGLHQWVDUHPL[HGWRJHWKHUDWRQHWLPH UDWKHUWKDQLQDVHULHVVSLNLQJWKXVUHGXFLQJIHUPHQWDWLRQWLPHDQGFRQVHTXHQWO\92&HPLVVLRQV7KH SURFHVVVWDUWVZLWKIORXUEHLQJORDGHGLQWRDVLORIROORZHGE\PL[LQJRILQJUHGLHQWVLQDPL[HU7KHPL[HG GRXJKLVWKHQVHQWWKURXJKDPHFKDQLFDOSURFHVVWKDWGLYLGHVURXQGVDQGPROGVWKHGRXJK$VWKHGRXJK PL[HULVORFDWHGLQVLGHWKH8WDK%DNHU\¶VEXLOGLQJDQGWKHSURFHVVFRQWDLQVZHWLQJUHGLHQWVWKHUHDUHIHZ DLUHPLVVLRQVDVVRFLDWHGZLWKWKLVSRUWLRQRIWKHEUHDGPDNLQJSURFHVVDOWKRXJKWKH\DUHDFFRXQWHGIRULQ WKHSURMHFW¶V37( 7KHGRXJKLVWKHQWUDQVIHUUHGWRDSURRIER[ZKHUHWKHSURGXFWLVH[SRVHGWRKHDWHGDQGKXPLGLILHG FRQGLWLRQVWKDWDOORZWKH\HDVWWRIHUPHQWDQGWKHGRXJKWRULVH+HDWLQJDQGKXPLGLILFDWLRQRIWKHSURRI ER[LVSURYLGHGE\VWHDPIURPWKHPDLQERLOHU7KHERLOHUVSURGXFHVWHDPE\KHDWLQJZDWHULQDQDWXUDO JDVILUHGSURFHVV%\SURGXFWVRIWKHQDWXUDOJDVFRPEXVWLRQSURFHVVDUHH[KDXVWHGWKURXJKDVWDFNRQWKH ERLOHU 2QFHWKHGRXJKULVHVWKHGRXJKLVWUDQVIHUUHGWRDWXQQHORYHQIRUEDNLQJ7KHRYHQLVILUHGE\QDWXUDOJDV 7KHE\SURGXFWVJHQHUDWHGIURPWKHQDWXUDOJDVFRPEXVWLRQDUHH[KDXVWHGWKURXJKH[KDXVWVWDFNVRQWKH WXQQHORYHQ7KHSURFHVVH[KDXVWLVYHQWHGWKURXJKWKHURRIRIWKH8WDK%DNHU\¶VEXLOGLQJDQGUHOHDVHGLQWR WKHDWPRVSKHUH 7KHILQLVKHGSURGXFWLVDOORZHGWRFRRODQGWKHSURGXFWLVODWHUVOLFHGSDFNDJHGDQGVKLSSHGRIIVLWHIRU VDOHDQGFRQVXPSWLRQ7KHUHDUHQRHPLVVLRQVDVVRFLDWHGZLWKWKHSDFNDJLQJSURFHVV ,WVKRXOGEHQRWHGWKDWHPLVVLRQVIRUERWKORDGLQJDQGXQORDGLQJDFWLYLWLHVDUHYHQWHGLQGRRUV $SURFHVVIORZGLDJUDP3)'IRUWKHEUHDGPDNLQJRSHUDWLRQLVVKRZQLQ)LJXUHDWWKHHQGRIWKLV VHFWLRQ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV %XQ3URGXFWLRQ 86%XVHVDVWUDLJKWGRXJKSURFHVVWRPDNHEXQV2SHUDWLRQVIRUEXQVDUHVLPLODUWRWKRVHRIEUHDG SURGXFWLRQOLVWHGDERYH7KHSURFHVVVWDUWVZLWKIORXUEHLQJORDGHGLQWRDVLORIROORZHGE\PL[LQJRI LQJUHGLHQWV$IWHUPL[LQJWKHGRXJKLVGLYLGHGURXQGHGDQGSODFHGLQWRDSURRIER[WRULVH7KHEXQVDUH ODWHUEDNHGLQDWUD\RYHQVOLFHGSDFNDJHGDQGVKLSSHGRIIVLWHIRUVDOHRUVROGRQVLWHDWWKHRXWOHWVWRUH $3)'RIWKHEXQPDNLQJRSHUDWLRQLVVKRZQLQ)LJXUHDWWKHHQGRIWKLVVHFWLRQ 3URFHVV)ORZ'LDJUDPV 3)'VIRUEUHDGDQGEXQSURGXFWLRQDUHVHWRXWEHORZ )LJXUH%UHDG3URGXFWLRQ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV )LJXUH%XQ3URGXFWLRQ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV (0,66,2165(/$7(',1)250$7,21 7KLVVHFWLRQGHWDLOVWKHPHWKRGRORJ\XVHGWRFDOFXODWHFRQWUROOHGDQGXQFRQWUROOHGHPLVVLRQVIRUFULWHULD SROOXWDQWVJUHHQKRXVHJDVHVDQG+$3VDVVRFLDWHGZLWKWKHLQFUHDVHLQWKURXJKSXWVDQGDVVRFLDWHG HPLVVLRQVDVUHJXODWHGE\5E$GGLWLRQDOO\DFRPSDULVRQWRPDMRUVRXUFHWKUHVKROGVLV FRQGXFWHG'HWDLOHGHPLVVLRQFDOFXODWLRQWDEOHVDUHLQFOXGHGDWWKHHQGRIWKLVVHFWLRQ <HDVW'HYHORSPHQW <HDVWGHYHORSPHQWLVWKHSULPDU\HPLVVLRQVRXUFHDWEDNHULHVHPLWWLQJ92&VLQWKHIRUPRIHWKDQRO,Q \HDVWOHDYHQHGEUHDGV\HDVWPHWDEROL]HVVXJDULQDQDQDHURELFIHUPHQWDWLRQSURFHVVSURGXFLQJFDUERQ GLR[LGH&2ZKLFKLVODUJHO\UHVSRQVLEOHIRUWKHGRXJKULVLQJ%HVLGHVWKH&2HTXLPRODUDPRXQWVRI HWKDQRODQGVPDOODPRXQWVRIRWKHUJO\FHUROVRUJDQLFDFLGVDOGHK\GHVDQGYDULRXVPLQRUFRPSRXQGVDUH SURGXFHG 7KHEDNLQJRYHQVDWWKH8WDK%DNHU\DUHILUHGE\QDWXUDOJDV,QVXFKRYHQVWKHHWKDQROYDSRUVIURPWKH EUHDGEXQVDQGRWKHUEDNHU\SURGXFWVDORQJZLWKE\SURGXFWJDVHVIURPFRPEXVWLRQDUHURXWHGWR H[KDXVWVWDFNVDQGHPLWWHGLQWRWKHDWPRVSKHUH3RWHQWLDO92&HPLVVLRQVIURPEDNLQJDUHFDOFXODWHGDQG WKHPHWKRGRORJ\IRUWKHVHFDOFXODWLRQVLVH[SODLQHGEHORZ7KHWHUPEUHDGXVHGWKURXJKRXWWKLVVHFWLRQ UHSUHVHQWVEUHDGRUEXQV 7RGHWHUPLQHWKH92&HPLVVLRQVIURPWKHEUHDGSURGXFWLRQSURFHVVHPLVVLRQIDFWRUVDUHFDOFXODWHGEDVHG RQWKHHTXDWLRQSUHVHQWHGLQ$3&KDSWHU7KH92&HPLVVLRQIDFWRUHTXDWLRQXVHGLQWKH VXEVHTXHQWFDOFXODWLRQVFRQIRUPWRWKHVSHFLILFDWLRQVUHTXLUHGE\8'$4SHUWKHLUFRPPXQLFDWLRQZLWK86% RQ0DUFK7KH92&HPLVVLRQIDFWRUVDQGVXEVHTXHQW92&HPLVVLRQVIURPEUHDGSURGXFWLRQZHUH FDOFXODWHGDVIROORZV Ǥ Ǥൌ ͲǤͻͷ୧ ൅ ͲǤͳͻͷ୧ െ ͲǤͷͳ െ ͲǤͺ͸ୱ ൅ͳǤͻͲ :KHUH 92&() 92&HPLVVLRQIDFWRUOE92&WRQEDNHGEUHDG <L ,QLWLDOEDNHU VSHUFHQWRI\HDVWWRWKHQHDUHVWWHQWKRIDSHUFHQW WL 7RWDO\HDVWDFWLRQWLPHLQKRXUVWRWKHQHDUHVWWHQWKRIDQKRXU IHUPHQWDWLRQWLPHIORRUWLPHLQWHUPHGLDWHSURRIWLPHILQDOSURRIWLPH 6 )LQDOVSLNHEDNHU VSHUFHQWRI\HDVWWRWKHQHDUHVWWHQWKRIDSHUFHQW WV 6SLNLQJWLPHLQKRXUVWRWKHQHDUHVWWHQWKRIDQKRXU IORRUWLPHLQWHUPHGLDWHSURRIWLPHILQDOSURRIWLPH 6XEVHTXHQWO\ ൌ ൬ ൰ൈሺሻ ൈ ൬ ൰ :KHUH 92&%DNLQJ(PLVVLRQV 92&VHPLWWHGWS\ 92&() 92&HPLVVLRQIDFWRUOE92&WRQEDNHGEUHDG %3 %UHDGSURGXFWLRQLQWRQVSHU\HDUWS\ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV 0DWHULDO+DQGOLQJ 7KH8WDK%DNHU\LVHTXLSSHGZLWKWKUHHVLORVIRUIORXUVWRUDJH)ORXULVORDGHGDQGXQORDGHGIURPWKHVH VLORVRQDUHJXODUEDVLV$VVXFKWKH8WDK%DNHU\ZLOOKDYHHPLVVLRQVRI30DQG30DVVRFLDWHGZLWKIORXU ORDGLQJXQORDGLQJDFWLYLWLHVXQGHUWKLVSURMHFW 7KHUHDUHDOVR30DQG30HPLVVLRQVDVVRFLDWHGZLWKPL[LQJIORXUZLWKRWKHUEDNLQJLQJUHGLHQWV7KH 8WDK%DNHU\LVHTXLSSHGZLWKWKUHHPL[HUVWKDWHPLW30DQG30$VVXFKWKHSRWHQWLDO30HPLVVLRQV DVVRFLDWHGZLWKKDQGOLQJIORXULVFDOFXODWHGLQDVVRFLDWLRQZLWKWKLVSURMHFW0HWKRGVIRUFDOFXODWLQJSRWHQWLDO HPLVVLRQVDVVRFLDWHGZLWKORDGLQJXQORDGLQJDFWLYLWLHVDQGPL[LQJLQJUHGLHQWVDUHGHWDLOHGEHORZ(PLVVLRQV DUHFDOFXODWHGIRUERWKORDGLQJDQGXQORDGLQJDFWLYLWLHVDQGPL[LQJ /RDGLQJ8QORDGLQJ$FWLYLWLHV ,WLVDVVXPHGWKDWHPLVVLRQVIURPIXJLWLYHIORXUGXVWZRXOGEHVLPLODUWRHPLVVLRQVIURPIXJLWLYHGXVWIRU DFWLYLWLHVDWDFRQFUHWHEDWFKSODQWDVWKHPDWHULDOFKDUDFWHULVWLFVLQFOXGLQJSDUWLFOHVL]HDUHVLPLODU$VVXFK HPLVVLRQIDFWRUVDVVRFLDWHGZLWKORDGLQJXQORDGLQJDFWLYLWLHVDUHIURP$37DEOH(PLVVLRQ)DFWRUV IRU&RQFUHWH%DWFKLQJ&RQFUHWHIRU&HPHQW6XSSOHPHQWWR(OHYDWHG6WRUDJH6LOR:KHUH30HPLVVLRQ IDFWRUVDUHQRWSURYLGHGLWLVDVVXPHGWKDWHPLVVLRQIDFWRUVIRU30DUHHTXDOWRHPLVVLRQIDFWRUVIRU30 3RWHQWLDOKRXUO\HPLVVLRQVDUHFDOFXODWHGDVIROORZV ൬ ൰ൌ ൬ ൰ ൈ ሺሻ ቀ ቁ $QQXDOHPLVVLRQVDUHVLPLODUO\FRPSXWHGXVLQJWKHIROORZLQJIRUPXOD ሺሻ ൌ ൬ ൰ ൈ ሺሻ ൈ ൬ ൰ 0L[LQJ 6LPLODUWRORDGLQJXQORDGLQJDFWLYLWLHVPL[LQJDFWLYLWLHVDWWKH8WDK%DNHU\DUHHYDOXDWHGXVLQJHPLVVLRQ IDFWRUVDVVRFLDWHGZLWKFHPHQWPDQXIDFWXULQJ6SHFLILFDOO\WKHHPLVVLRQIDFWRUVDUHH[WUDFWHGIURP$3 6HFWLRQ(PLVVLRQ)DFWRUVIRU&RQFUHWH%DWFKLQJ0L[HU/RDGLQJ7KHSRWHQWLDOHPLVVLRQVDUH FDOFXODWHGDVIROORZV +RXUO\(PLVVLRQV ൬ ൰ൌ ൬ ൰ ൈ ൬ ൰ ൈ ൬ ൰ $QQXDO(PLVVLRQV ሺሻ ൌ ൬ ൰ ൈ ൬ ൰ ൈ ൬ ൰ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV 6RXUFH6L]H'HWHUPLQDWLRQ $VSUHVHQWHGLQWKHHPLVVLRQFDOFXODWLRQVVXPPDU\LQWKLV12,DLUSHUPLWDSSOLFDWLRQSURSRVHGHPLVVLRQVDWWKH8WDK%DNHU\DUHOHVVWKDQ PDMRUVRXUFHWKUHVKROGV067LHWRQVIRUDQ\FULWHULDSROOXWDQWZLWKH[FHSWLRQWRGLUHFW30DQGLWVSUHFXUVRUVIRUZKLFKWKH067 LVWS\WRQVIRUDQ\+$3WRQVIRUDOO+$3VFRPELQHGDQGWRQVIRU&2H7KHUHIRUHWKH8WDK%DNHU\ZLOOFRQWLQXHWREH FODVVLILHGDVDPLQRUVRXUFH 7DEOH3URMHFWHG(PLVVLRQVIRU6RXUFH6L]H'HWHUPLQDWLRQ (PLVVLRQ3RLQW 37((PLVVLRQ5DWH WS\ 30306212;92&&27RWDO +$3V&2H 7RWDO3URMHFW,QFUHDVH &XUUHQW3HUPLWWHG37( 3RVW3URMHFW37( 0DMRU6RXUFH7KUHVKROG 1025 0DMRU6RXUFH7KUHVKROG([FHHGHG" 1R 1R 1R 1R 1R 1R 1R 1R $SSURYDO2UGHU'$4($1 0DMRUVRXUFHHPLVVLRQWKUHVKROGVDUHGHILQHGE\&)5DLY$GHILQLWLRQRID0DMRUVWDWLRQDU\VRXUFHIRU30DQGLWVSUHFXUVRUV0DMRUVRXUFHHPLVVLRQWKUHVKROGV DUHGHILQHGE\&)5ELEIRU30DQG&2LHSROOXWDQWVIRUZKLFK6DOW/DNH&RXQW\LVLQDWWDLQPHQW7RWDO+$3WKUHVKROGLVJLYHQLQ&)5XQGHUGHILQLWLRQRID0DMRUVRXUFH 86%LVORFDWHGLQWKH6DOW/DNH1RQDWWDLQPHQWDUHDIRU306LQFHWKH6DOW/DNH30QRQDWWDLQPHQWDUHDKDVEHHQGHVLJQDWHGDVVHULRXVQRQDWWDLQPHQWWKH PDMRUVRXUFHWKUHVKROGLVWS\IRUGLUHFW30DQGLWVSUHFXUVRUV12;6292&VDQG1+ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV %(67$9$,/$%/(&21752/7(&+12/2*<$1$/<6,6 ,QWKH6WDWHRI8WDKXQGHU5G1RWLFHRI,QWHQWHYHU\IDFLOLW\RSHUDWLRQRUSURFHVVWKDW SURSRVHVDQ\DFWLYLW\WKDWZRXOGHPLWDQDLUFRQWDPLQDQWLQWRWKHDLUPXVWFRQVLGHU%$&7IRUDSURSRVHG QHZVRXUFHRUPRGLILFDWLRQWRDQH[LVWLQJVRXUFH7KH%$&7DQDO\VLVSUHSDUHGIRUWKLVDSSOLFDWLRQRQO\ DGGUHVVHVXQLWVZKLFKZLOOEHPRGLILHGLQVWDOOHGRURWKHUZLVHDGGUHVVHGLQWKHPRGLILHG$SSURYHG2UGHU 6SHFLILFDOO\WKH%$&7DQDO\VLVDGGUHVVHV3030DQG92&HPLVVLRQVIURPWKHEDNHU\HTXLSPHQW7KH DQDO\VLVIROORZVWKH8QLWHG6WDWHV(QYLURQPHQWDO3URWHFWLRQ$JHQF\¶V(3$¶VSUHIHUUHG³WRSGRZQ´ PHWKRGRORJ\ <HDVW'HYHORSPHQW <HDVW'HYHORSPHQW92&%$&7 7KHSURGXFWLRQRI92&HPLVVLRQVDWWKH8WDK%DNHU\SULPDULO\LQWKHIRUPRIHWKDQROUHVXOWIURPWKH\HDVW IHUPHQWDWLRQ<HDVWLVSULPDULO\IHUPHQWHGLQWKHSURRIER[HVDWWKH8WDK%DNHU\DOWKRXJKVRPHIHUPHQWLQJ DOVRRFFXUVLQWKHRYHQV7KHH[KDXVWIURPRYHQVDQGSURRIER[HVDUHVLPLODUDQGWKHUHIRUHIRUSXUSRVHV RIWKLV12,DLUSHUPLWDSSOLFDWLRQDUHFRQVLGHUHGLQWKHVDPH%$&7DQDO\VLVIRU92&V7KHLQFUHDVHLQ92& HPLVVLRQUDWHVIURPWKHSHUPLWWHG37(WRWKHSURSRVHG37(LVWS\IURP\HDVWGHYHORSPHQW LQRYHQVDQGSURRIER[HVFRPELQHG7KHFRPEXVWLRQRIQDWXUDOJDVE\WKHRYHQVUHPDLQVXQFKDQJHGDQG LVWKHUHIRUHQRWFRQVLGHUHGLQWKLV%$&7DQDO\VLV 6WHS±,GHQWLI\$OO$YDLODEOH&RQWURO7HFKQRORJLHV 7KHILUVWVWHSLQWKH%$&7DQDO\VLVLVWRLGHQWLI\DOODYDLODEOHFRQWUROWHFKQRORJLHV92&FRQWUROWHFKQRORJLHV ZHUHLGHQWLILHGIURP7ULQLW\¶VVHDUFKEDVHGRQWKHIROORZLQJUHIHUHQFHV ჭ%D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW%$$40' ჭ6RXWK&RDVW$LU4XDOLW\0DQDJHPHQW'LVWULFW6&$40' ჭ6DQ-RDTXLQ9DOOH\$LU3ROOXWLRQ&RQWURO'LVWULFW6-9$3&'DQG ჭ6HDUFKRIWKH5$&7%$&7/$(5&OHDULQJKRXVH5%/&FRQGXFWHGRQ0D\ )URPWKLVUHYLHZ7ULQLW\LGHQWLILHGILYHDYDLODEOHFRQWUROWHFKQRORJLHVZKLFKDUHGHVFULEHGEHORZ &DUERQ$GVRUSWLRQ8QLW $FDUERQDGVRUSWLRQXQLWLVDPHDQVRIHPLVVLRQFRQWUROWKDWFRQVLVWVRIRQHWRVHYHUDOEHGVRIDFWLYDWHG FDUERQWKURXJKZKLFKH[KDXVWSDVVHV$FWLYDWHGFDUERQDGVRUEVWKH92&VLQWKHH[KDXVWRQWRLWVODUJH VXUIDFHDUHDUHVXOWLQJLQFOHDQDLUIRUHPLVVLRQ2YHUWLPHWKHEHGRUEHGVEHFRPHVDWXUDWHGDVWKH92&V ILOOLQFDUERQVXUIDFHDUHDUHGXFLQJHIILFLHQF\7KHFDUERQEHGVDUHUHJHQHUDWHGE\SDVVLQJVWHDPWKURXJK WKHPVWULSSLQJWKH92&VIURPWKHFDUERQSDUWLFOHV92&VDUHUHFRYHUHGIURPWKHVWHDPE\FRQGHQVLQJWKH PL[WXUHDOORZLQJIRUGLVSRVDORUUHFRYHU\&DUERQDGVRUSWLRQXQLWVW\SLFDOO\DFKLHYHXSWR92& UHGXFWLRQHIILFLHQFLHV &DWDO\WLF2[LGL]HU &DWDO\WLFR[LGDWLRQLVWKHSURFHVVRIR[LGL]LQJRUJDQLFFRQWDPLQDQWVLQDZDVWHJDVVWUHDPZLWKLQDKHDWHG FKDPEHUWKDWFRQWDLQVDFDWDO\VWEHG7KLVLVGRQHLQWKHSUHVHQFHRIR[\JHQWRDOORZIRUVXIILFLHQWWLPHWR (3$2IILFHRI$LUDQG5DGLDWLRQ0HPRUDQGXPIURP-&3RWWHUWRWKH5HJLRQDO$GPLQLVWUDWRUV:DVKLQJWRQ'&'HFHPEHU &KDSWHU&DUERQ$GVRUEHUV(3$¶V0RQLWRULQJE\&RQWURO7HFKQLTXHSXEOLFDWLRQ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV FRPSOHWHO\R[LGL]HWKHRUJDQLFFRQWDPLQDQWVRIWKHZDVWHJDVVWUHDPLQWRFDUERQGLR[LGHDQGZDWHU7KH FDWDO\VWLVXVHGWRORZHUWKHDFWLYDWLRQHQHUJ\RIWKHR[LGDWLRQUHDFWLRQ7KHUHVLGHQFHWLPHWHPSHUDWXUH IORZYHORFLW\PL[LQJR[\JHQFRQFHQWUDWLRQDQGW\SHRIFDWDO\VWXVHGLQWKHFRPEXVWLRQFKDPEHUDOODIIHFW WKHR[LGDWLRQUDWHDQGGHVWUXFWLRQFRQYHUVLRQHIILFLHQF\&DWDO\WLFR[LGL]HUVW\SLFDOO\UHTXLUHFRPEXVWLRQRI DQDX[LOLDU\IXHOHJQDWXUDOJDVWRPDLQWDLQWKHFRPEXVWLRQFKDPEHUWHPSHUDWXUHKLJKHQRXJKWR FRPSOHWHO\R[LGL]HWKHFRQWDPLQDQWJDVHVDQGDVZLWKWKHUPDOR[LGL]HUVIXPHSUHKHDWLQJGHYLFHVDUH FRPPRQO\XVHGWRPLQLPL]HRSHUDWLQJFRVWV&DWDO\WLFR[LGL]HUVDUHW\SLFDOO\GHVLJQHGWRKDYHDUHVLGHQFH WLPHRIVHFRQGVRUOHVVDQGFRPEXVWLRQFKDPEHUWHPSHUDWXUHVEHWZHHQDQGGHJUHHV )DKUHQKHLW)&DWDO\WLFR[LGL]HUVKDYHD92&FRQWUROHIILFLHQF\RI &RQGHQVDWLRQ8QLW (PLVVLRQVVRXUFHVWKDWKDYHORZIORZUDWHVRIKLJKFRQFHQWUDWLRQ92&VXSWRVXFKDVWDQNYHQWV DUHLGHDODSSOLFDWLRQVIRUUHIULJHUDWHGDQGFU\RJHQLFFRQGHQVHUV7KHFRQGHQVHGOLTXLGLVUHWXUQHGWRWKH SURFHVVDQGQRQFRQGHQVDEOHOLTXLGVZLWKORZOHYHOVRI92&VDUHYHQWHGWRWKHDWPRVSKHUH ჭ6LQJOHVWDJHFRQGHQVLQJV\VWHPVZKLFKFDQUHGXFHWKHYHQWHGJDVVWUHDPWRPLQXV)FDQEH XVHGIRUKLJKERLOLQJFRPSRXQGVVXFKDVJDVROLQHWDQNYDSRUVIURPWDQNWUDQVIHURSHUDWLRQVDQGFDQ DFKLHYHFRQWUROHIILFLHQFLHV+LJKFRQWUROHIILFLHQFLHVUHTXLUHORZHUWHPSHUDWXUHVDQGPRUH FRPSOH[LW\VXFKDVPXOWLSOHVWDJHVDQGSXPSLQJV\VWHPV ჭ&DVFDGHPXOWLVWDJHFRQGHQVLQJV\VWHPVXVHFU\RJHQLFVWKDWFDQSURGXFHWHPSHUDWXUHVDVORZ DVPLQXV)7KHVHV\VWHPVDUHUHTXLUHGIRUORZHUPROHFXODUZHLJKW92&VZLWKKLJKYDSRU SUHVVXUHVRUIRUYHQWVWUHDPVZLWKVLJQLILFDQWFRQGHQVDEOHVVXFKDVQLWURJHQIURPDLU 5HJXODU&OHDQLQJ2SHUDWLRQV 5HJXODUFOHDQLQJRSHUDWLRQVUHGXFHWKHSURGXFWLRQRI92&HPLVVLRQVE\SUHYHQWLQJIHUPHQWDWLRQIURP RFFXUULQJGXULQJWLPHVZKHQEDNHU\RSHUDWLRQVDUHQRWRFFXUULQJ%\UHPRYLQJH[FHVV\HDVWFRQWDLQLQJ PDWHULDOVWKHIHUPHQWDWLRQSURFHVVLVKDOWHGWKXVVWRSSLQJWKHSURGXFWLRQRI92&V5HJXODUFOHDQLQJ RSHUDWLRQVLQDFFRUGDQFHZLWKWKHVWDQGDUGWKDWKDVEHHQIRXQGLQWKH5%/&VHDUFKLQFOXGH ჭ:HHNO\&OHDQLQJ 5HPRYDORIGRXJKDQGRUEUHDGIURPWKHRYHQVDQGSURRIER[HVZKHWKHUE\VFUDSLQJDQGVZHHSLQJ RURWKHUZLVH ჭ0RQWKO\&OHDQLQJ :LSLQJRIIWKHLQWHULRURIWKHRYHQVDQGSURRIER[HVZKHUHQHFHVVDU\ 5HPRYDORIRLOGRXJKEUHDGRURWKHUDFFXPXODWHGZDVWHIURPWKHLQWHULRUDQGH[WHULRURIWKHRYHQV DQGSURRIER[HV 7KHUPDO2[LGL]HU 7KHUPDOR[LGL]HUV72VUHJXODUO\DFKLHYHXSWRGHVWUXFWLRQHIILFLHQFLHVEHFDXVHRIWKHLQKHUHQW HIILFLHQF\RIWKHFRPEXVWLRQSURFHVVHV72VW\SLFDOO\FRQVLVWRIDQHQFORVHGFRPEXVWLRQFKDPEHUZLWKDQ DX[LOLDU\EXUQHUILUHGZLWKDFRQYHQWLRQDOIXHO7KHILULQJUDWHRIWKHEXUQHULVDXWRPDWLFDOO\FRQWUROOHGWR PDLQWDLQDSUHVHWFRPEXVWLRQFKDPEHUWHPSHUDWXUH72VSURYLGHPD[LPXPRSHUDWLQJIOH[LELOLW\EHFDXVH WKH\FDQKDQGOH&2DQGPRVWNQRZQ92&VDWDZLGHUDQJHRIFRQFHQWUDWLRQVDQGIORZV+RZHYHU72V UHTXLUHUHODWLYHO\KLJKIXHOLQSXWEHFDXVHRIRSHUDWLQJWHPSHUDWXUHV+HDWUHFRYHU\LVIUHTXHQWO\XVHGZLWK 72V\VWHPVWRPLQLPL]HWKHIXHORSHUDWLQJFRVWHVSHFLDOO\ZLWKORZFRQFHQWUDWLRQVRI92&+HDWUHFRYHU\ 3HU(3$$LU3ROOXWLRQ&RQWURO7HFKQRORJ\)DFW6KHHW7KHUPDO,QFLQHUDWRU(3$) 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV GHYLFHVXVHGLQ92&V\VWHPVDUHPRVWFRPPRQO\LQGLUHFWUHFXSHUDWLYHKHDWH[FKDQJHUVRUWKHUPDOPDVV UHJHQHUDWLYHKHDWH[FKDQJHUV 7KHWKUHHPDLQW\SHVRI72V\VWHPVLQFOXGHGLUHFWIODPHUHJHQHUDWLYH72DQGUHFXSHUDWLYH72ZKLFK DUHGLIIHUHQWLDWHGE\WKHW\SHRIKHDWUHFRYHU\HTXLSPHQWXVHG ჭ'LUHFW)ODPH$GLUHFWIODPHWKHUPDOR[LGL]HUFRQVLVWVRIRQO\DFRPEXVWLRQFKDPEHUZLWKQRKHDW UHFRYHU\HTXLSPHQW ჭ5HJHQHUDWLYH7KHUPDO2[LGL]HUV7KHVHV\VWHPVHPSOR\DODUJHWKHUPDOPDVVWRFROOHFWKHDWDQGUHWXUQ LWWRWKHLQFRPLQJIXPH(DFKR[LGL]HULVVXSSOLHGZLWKVHYHUDOODUJH³FHOOV´ZKLFKDUHILOOHGZLWKFHUDPLF SDFNLQJ7KHFHOOVDUHDOWHUQDWHGIURPKHDWXSWRFRROGRZQF\FOHVIRUIXPHSUHKHDWLQJE\DVHULHVRI GDPSHUVDQGGXFWVRQWKHRXWOHWVLGHRIWKHV\VWHP7KHVHXQLWVFDQDFKLHYHKLJKUHPRYDOHIILFLHQFLHV DWUHODWLYHO\ORZWHPSHUDWXUHV)EHFDXVHRIWKHWKRURXJKPL[LQJLQWKH FHUDPLFSDFNLQJVHFWLRQV7KHVHV\VWHPVDUHPRUHPDLQWHQDQFHLQWHQVLYHWKDQUHFXSHUDWLYHW\SHV EHFDXVHRIWKHPHFKDQLFDOV\VWHPWKDWSHUIRUPVWKHDOWHUQDWLQJRIFHOOV ჭ5HFXSHUDWLYH7KHUPDO2[LGL]HUV7KHVHV\VWHPVHPSOR\DQLQGLUHFWKHDWH[FKDQJHUGHYLFHWRSUHKHDW WKH92&DQG&2ODGHQIXPH7KH\DUHDSSOLHGWRR[LGL]HUVWKDWRSHUDWHDWWHPSHUDWXUHVDVKLJKDV )7KHPD[LPXPGHVLJQHIILFLHQF\LVXVXDOO\GLFWDWHGE\WKHH[FKDQJHURXWOHWWHPSHUDWXUHDQG WKH92&FRQWHQWLQWKHVWUHDP ,QJHQHUDO72VDUHOHVVHIILFLHQWDWWUHDWLQJZDVWHJDVVWUHDPVZLWKKLJKO\YDULDEOHIORZUDWHVVLQFHWKH YDULDEOHIORZUDWHUHVXOWVLQYDU\LQJUHVLGHQFHWLPHVFRPEXVWLRQFKDPEHUWHPSHUDWXUHDQGSRRUPL[LQJ :HW3DFNHG%HG6FUXEEHU $ZHWSDFNHGEHGVFUXEEHULVDQDLUSROOXWLRQFRQWUROGHYLFHWKDWUHPRYHV92&VIURPVWDWLRQDU\SRLQWVRXUFH ZDVWHVWUHDPV92&VDUHSULPDULO\UHPRYHGWKURXJKWKHLPSDFWLRQGLIIXVLRQLQWHUFHSWLRQDQGRU DEVRUSWLRQRIWKHSROOXWDQWRQWRGURSOHWVRIOLTXLG7KLVZHLJKVWKHGURSOHWVGRZQVXFKWKDWWKH\IDOOEDFNWR WKHVXUIDFHRIWKHSDFNHGEHG:HWSDFNHGEHGVFUXEEHUVFDQW\SLFDOO\DWWDLQUHPRYDOHIILFLHQFLHVJUHDWHU WKDQIRU92&VLQJHQHUDO 6WHS±(OLPLQDWH7HFKQLFDOO\,QIHDVLEOH2SWLRQV ,QWKHVHFRQGVWHSRIWKH%$&7DQDO\VLV7ULQLW\HOLPLQDWHGDOODYDLODEOHFRQWURORSWLRQVWKDWDUHWHFKQLFDOO\ LQIHDVLEOH &DUERQ$GVRUSWLRQ8QLW &DUERQDGVRUSWLRQFRQWUROXQLWVDUHWHFKQRORJLFDOO\LQIHDVLEOHIRUEDNHU\RSHUDWLRQVIRUVHYHUDOUHDVRQV )LUVWHWKDQROLVWKHSULPDU\RUJDQLFJDVSUHVHQWLQH[KDXVWIURPEDNLQJRSHUDWLRQVHWKDQROKDVDKLJK DIILQLW\WRFDUERQPHDQLQJWKDWLWLVQRWHDVLO\VWULSSHGIURPWKHDFWLYDWHGFDUERQSDUWLFOHVRQFHLWLV DGVRUEHG7KLVOHDGVWRORZHUFRQWUROHIILFLHQFLHVDIWHULQLWLDOXVHGHFUHDVLQJPRUHDQGPRUHDVWKHSDUWLFOHV DUHIXUWKHUXVHG,QDGGLWLRQRLOVDQGIDWVSUHVHQWLQRYHQH[KDXVWFORJWKHSRUHVRIWKHFDUERQSDUWLFOHV ZKLFKDOVRUHGXFHVWKHOLIHDQGXWLOLW\RIWKHXQLW&DUERQDGVRUSWLRQXQLWVDUHWKHUHIRUHWHFKQRORJLFDOO\ LQIHDVLEOHIRUEDNHU\RSHUDWLRQVDQGQRWDYLDEOHFRQWUROWHFKQRORJ\IRUWKH8WDK%DNHU\ &DWDO\WLF2[LGL]HU &DWDO\WLFR[LGL]HUVDUHW\SLFDOO\GHVLJQHGWRKDYHDUHVLGHQFHWLPHRIVHFRQGVRUOHVVDQGFRPEXVWLRQ FKDPEHUWHPSHUDWXUHVEHWZHHQ)7KLVLVWHFKQLFDOO\IHDVLEOHIRUWKHRYHQVDQGSURRIER[HV 3HU(3$$LU3ROOXWDLRQ&RQWURO7HFKQRORJ\)DFW6KHHW3DFNHG%HG3DFNHG7RZHU:HW6FUXEEHU(3$) 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV &RQGHQVDWLRQ8QLW (PLVVLRQVVRXUFHVWKDWKDYHORZIORZUDWHVRIKLJKFRQFHQWUDWLRQ92&VXSWRVXFKDVWDQNYHQWVDUH LGHDODSSOLFDWLRQVIRUUHIULJHUDWHGDQGFU\RJHQLFFRQGHQVHUV%HFDXVHWKH%DNHU\¶VRYHQVDUHQHLWKHUD FRQGHQVDWLRQXQLWLVQRWDQRSWLPDOFRQWUROWHFKQRORJ\)URPWKH5%/&VHDUFKFRQGHQVDWLRQKDVQRWSURYHQ WHFKQRORJLFDOO\IHDVLEOHIRUWKHFRQWURORI92&VLQEDNHU\RYHQVLQSDUWEHFDXVHRIWKHLUKLJKDLUIORZUDWHV $GGLWLRQDOO\WKHUHLVDQDGGHGGLIILFXOW\LQWKHWUHDWPHQWDQGGLVSRVDORIWKHUHVXOWLQJZDVWHZDWHU)RUWKHVH UHDVRQVFRQGHQVDWLRQXQLWVDUHQRWWHFKQLFDOO\IHDVLEOHDWWKH%DNHU\ 5HJXODU&OHDQLQJ2SHUDWLRQV 5HJXODU&OHDQLQJ2SHUDWLRQVWRUHPRYHH[FHVV\HDVWFRQWDLQLQJPDWHULDOVDUHWHFKQLFDOO\IHDVLEOHWRPLWLJDWH 92&HPLVVLRQVGXULQJWLPHVZKHQEDNHU\RSHUDWLRQVDUHQRWRFFXUULQJ 7KHUPDO2[LGL]HU %DVHGRQ7ULQLW\¶VUHVHDUFKWKHUPDOR[LGL]LQJFRQWUROVDUHFRQVLGHUHGWHFKQLFDOO\IHDVLEOHDWWKH%DNHU\DQG KDYHKLJKHUFRQWUROHIILFLHQFLHVWKDQGRFDWDO\WLFR[LGL]HUV+RZHYHU72VRSHUDWHDWKLJKHURSHUDWLQJ WHPSHUDWXUHVWKDQFDWDO\WLFR[LGL]HUVZKLFKUHTXLUHVKLJKHUYROXPHVRIQDWXUDOJDVFRQVXPSWLRQ :HW3DFNHG%HG6FUXEEHU :HWSDFNHGEHGVFUXEEHUVDUHWHFKQLFDOO\IHDVLEOHDVDFRQWUROPHWKRGIRU92&HPLVVLRQVDWWKH8WDK %DNHU\ 6WHS±5DQN5HPDLQLQJ&RQWURO7HFKQRORJLHVE\&RQWURO(IIHFWLYHQHVV 7ULQLW\UDQNHGWKHSRWHQWLDOFRQWUROWHFKQRORJLHVSUHVHQWHGDERYHEDVHGRQFRQWUROHIILFLHQFLHVGRFXPHQWHG LQ(3$¶V)DFW6KHHWVDVGHVFULEHGLQ7DEOH 7DEOH6XPPDU\IRU2YHQVDQG3URRI%R[HV92&(PLVVLRQ&RQWURO &RQWURO7HFKQRORJLHV5DQN 3HUFHQW &RQWURO &DWDO\WLF2[LGL]HU 7KHUPDO2[LGL]HU :HW3DFNHG%HG6FUXEEHUV 3URSHU&OHDQLQJ2SHUDWLRQV 9DULDEOH 6WHS±(YDOXDWH0RVW(IIHFWLYH&RQWUROV &DWDO\WLF2[LGDWLRQ 7ULQLW\HVWLPDWHGWKHIORZUDWHGHVWUXFWLRQHIILFLHQF\DQGFRVWRIDFDWDO\WLFR[LGDWLRQFRQWUROV\VWHPEDVHG RQXQLWVLQVWDOOHGDWVLPLODUIDFLOLWLHVZLWKLQWKH6&$40'DQGWKH3XJHW6RXQG&OHDQ$LU$JHQF\DUHDV%DVHG RQDFRPSDULVRQRIVL]HDQGRSHUDWLQJSDUDPHWHUV7ULQLW\GHYHORSHGDQHVWLPDWHGPLQLPXPFRVWRID FDWDO\WLFR[LGL]HUDWWKH8WDK%DNHU\$OOFRVWHVWLPDWHLQIRUPDWLRQDQGGHWDLOVDUHSURYLGHGLQ$SSHQGL[&RI WKLV12,DLUSHUPLWDSSOLFDWLRQ 7KLVDQDO\VLVLVEDVHGRQLQIRUPDWLRQJLYHQE$3$LQ&KDSWHURILWV&RVW5HSRUWVDQG*XLGDQFHIRU$LU 3ROOXWLRQ5HJXODWLRQVPDQXDOZKHUHWKHDQQXDOL]HGFRVWRIDSLHFHRIHTXLSPHQWLVJLYHQLQWKHIROORZLQJ HTXDWLRQ ܲܯܶ ൌ ܸܰܲ ൈ ൬ ݅ ͳെሺͳ൅݅ሻି௡ ൰ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV :KHUH 307 (TXLYDOHQWXQLIRUPSD\PHQWDPRXQWRYHUWKHOLIHRIWKHFRQWUROHTXLSPHQWLQ86GROODUV 139 1HW3UHVHQW9DOXHLQ86GROODUV L ,QWHUHVWUDWHDQG Q /LIHRIWKHFRQWUROHTXLSPHQW 7KLVFKDSWHUVWDWHVWKDWWKHOLIHRIDSLHFHRIHTXLSPHQWሺ࢔ሻLVWZHQW\\HDUVXQOHVVVSHFLILFDOO\JLYHQ 7KHGHIDXOWLQWHUHVWUDWH࢏LVDVVXPHGWREHWKHFXUUHQWDYHUDJH6PDOO%XVLQHVV$GPLQLVWUDWLRQ6%$/RDQ 5DWHRI2WKHUFRVWVGHVFULEHGLQ&KDSWHURI(3$¶V$LU3ROOXWLRQ&RQWURO&RVW0DQXDOZHUHDOVR LQFOXGHGLQWKHHFRQRPLFHYDOXDWLRQVXFKDVODERUFRVWVXWLOLW\FRVWVHTXLSPHQWFRVWVLQVWDOODWLRQFRVWV HWF ,Q(3$¶V$LU3ROOXWLRQ&RQWURO7HFKQRORJ$DFW6KHHWIRU&DWDO\WLF,QFLQHUDWRUVLHFDWDO\WLFR[LGL]HUVWKH GHVWUXFWLRQHIILFLHQFLHVRIFDWDO\WLFR[LGL]HUVDUHJLYHQIRU92&VZKLFKLVJLYHQDV7KH307HTXDWLRQ ZDVXVHGIRUWKHFRPELQHGLQFUHDVHRI92&VUHVXOWLQJIURPDQLQFUHDVHLQSURGXFWWKURXJKSXWZKLFKLV HPLWWHGIURPWKHRYHQVDQGSURRIER[HV 7DEOH$QQXDO&RVWVRI&DWDO\WLF2[LGL]HU2SHUDWLRQ &RVWV 7RWDO&DSLWDO,QYHVWPHQW 7RWDO$QQXDO&RVW &RVWSHU7RQRI3ROOXWDQW5HPRYHGWRQ 7KHFRVWVOLVWHGDERYHZHUHFDOFXODWHGXVLQJLQIRUPDWLRQIURPFDWDO\WLFR[LGL]HUVDWVLPLODUEDNHULHVDVD FRQVHUYDWLYHDSSURDFK$WSHUWRQRI92&VUHPRYHGFDWDO\WLFR[LGL]HUVDUHQRWDQHFRQRPLFDOO\ IHDVLEOHFRQWUROWHFKQRORJ\IRU92&V 7KHUPDO2[LGL]HU 7KHHFRQRPLFIHDVLELOLW\DQDO\VLVZDVGRQHDVGHVFULEHGDERYHLQWKHFDWDO\WLFR[LGL]HU¶VGHVFULSWLRQ 7DEOH$QQXDO&RVWVRI7KHUPDO2[LGL]HU2SHUDWLRQ &RVWV 7RWDO&DSLWDO,QYHVWPHQW 7RWDO$QQXDO&RVW &RVWSHU7RQRI3ROOXWDQW5HPRYHGWRQ 7KHFRVWVOLVWHGDERYHZHUHFDOFXODWHGXVLQJLQIRUPDWLRQIURP72VDWVLPLODURSHUDWLRQVDVDFRQVHUYDWLYH DSSURDFKZKLFKKDVGHPRQVWUDWHGWREHHFRQRPLFDOO\LQIHDVLEOH7KHUHVXOWLQJYDOXHRISHUWRQRI 92&VUHPRYHGUHQGHUV72VDVDQHFRQRPLFDOO\LQIHDVLEOHFRQWUROWHFKQRORJ\IRU92&VDWWKH%DNHU\ )URP(3$¶V$LU3ROOXWLRQ&RQWURO7HFKQRORJ\)DFW6KHHW&DWDO\WLF,QFLQHUDWRU &RVWVDUHUHSUHVHQWDWLYHRI86(3$2$436(3$$LU3ROOXWLRQ&RQWURO&RVW0DQXDOWK(GLWLRQ-DQXDU\6HFWLRQ &KDSWHU(TXDWLRQDQGDUHVFDOHGEDVHGRQWKHJDVIORZUDWHVRI3XJHW6RXQG&OHDQ$LU$JHQF\3HUPLWWR&RQVWUXFW DQG6&$40'3HUPLWWR&RQVWUXFW7KLVDSSURDFKZDVFKRVHQWRGHPRQVWUDWHWKHPLQLPXPFRVWRIFRQWUROLH DFRQVHUYDWLYHDSSURDFKWRWKH%$&7HFRQRPLFVDQDO\VLVDVDVLWHVSHFLILFGHVLJQKDVQRWEHHQGHYHORSHGDQGDGGLWLRQDOFRVW IDFWRUVKDYHQRWEHHQLQFOXGHG ,ELG 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV :HW3DFNHG%HG6FUXEEHU 7KHXVHRIVFUXEELQJFRQWUROWHFKQRORJ\LQWURGXFHVLVVXHVDVVRFLDWHGZLWKVXEVWDQWLDOZDWHUQHHGVDQG ZDVWHZDWHUSURGXFWLRQGLVSRVDO7KHSURFHVVSURGXFHVZDVWHZDWHUWKDWUHTXLUHVWKHXVHRULQVWDOODWLRQRID ZDVWHZDWHUWUHDWPHQWSODQWRUHWKDQROUHFRYHU\XQLWDUJXDEO\RXWZHLJKLQJWKHEHQHILWVIURPLWV92& DEVRUSWLRQ7KLVZDVWHPXVWEHSURSHUO\KDQGOHGWUHDWHGDQGGLVSRVHGRIDWDZDVWHWUHDWPHQWIDFLOLW\RU ODQGILOO)RUWKHVHUHDVRQVDZHWSDFNHGEHGVFUXEEHUDV92&FRQWUROWHFKQRORJ\KDVEHHQHOLPLQDWHGIURP IXUWKHUFRQVLGHUDWLRQ 3URSHU&OHDQLQJ2SHUDWLRQV 7KHUHDUHQRHQYLURQPHQWDOHQHUJHWLFRUHFRQRPLFUHDVRQVWKDWSURSHUFOHDQLQJRSHUDWLRQVFDQQRWEH HPSOR\HGDWWKH8WDK%DNHU\ 6WHS6HOHFW%$&7 $VUHJXODUFOHDQLQJRSHUDWLRQVDUHWKHRQO\FRQWUROPHWKRGFRQVLGHUHGWHFKQRORJLFDOO\DQGHFRQRPLFDOO\ IHDVLEOHWKH\DUHVHOHFWHGDV%$&7IRUWKHSURMHFW 0L[HUVDQG6LORV 0L[HUVDQG6LORV30DQG30%$&7 6WHSV 7ZRPL[HUVDQGWZRVLORVZLWKLQWKH8WDK%DNHU\ZLOOEHDIIHFWHGE\WKLVSURMHFWDQGDOODUH FRPSOHWHO\FRQWDLQHGZLWKLQWKH8WDK%DNHU\¶VEXLOGLQJ%HFDXVHWKHPL[HUVDUHHQFORVHGWKH8WDK%DNHU\ TXDOLILHVIRUDZLGHO\XVHG30DQG30FRQWUROWHFKQRORJ\WKDWFRQVLVWVRIFRQILQLQJHPLVVLRQVWRDQ HQFORVHGDUHDSURKLELWLQJSDUWLFXODWHHPLVVLRQVIURPUHDFKLQJDPELHQWDLU7KHFRQWUROHIILFLHQFLHVRI HQFORVXUHVUDQJHIURPZLWKHPLVVLRQFRQWURODFKLHYHGZKHUHWKHHTXLSPHQWUHVLGHVZLWKLQ WRWDOO\HQFORVHGVWUXFWXUHV$VWKLVLVWKHFDVHIRUWKHPL[HUVDQGWKHVLORVDWWKH8WDK%DNHU\HQFORVXUHV DUHFRQVLGHUHG%$&7IRU30DQG30HPLVVLRQVIURPWKLVHTXLSPHQW 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV (0,66,21,03$&7$1$/<6,6 &RPSDULVRQWR0RGHOLQJ7KUHVKROGV $VQRWHGLQWKHHPLVVLRQFDOFXODWLRQVDQGGHVFULEHGEHORZWKHSURSRVHGVLWHZLGHHPLVVLRQFKDQJHVDUHOHVVWKDQWKH8'$4PRGHOLQJ WKUHVKROGVFRQWDLQHGLQ8$&5$VDUHVXOWQRFULWHULDSROOXWDQWPRGHOLQJDQDO\VLVLVUHTXLUHG 7DEOHFRPSDUHVFULWHULDSROOXWDQWWRWDOSURSRVHGHPLVVLRQVWRDSSOLFDEOHPRGHOLQJWKUHVKROGVFRQWDLQHGLQ5WKURXJKDQG 5 7DEOH3URMHFWHG(PLVVLRQV6XPPDU\RIWKH3URMHFW (PLVVLRQ3RLQW 37((PLVVLRQ5DWH WS\ 30306212;92&&27RWDO +$3V&2H 0DWHULDO+DQGOLQJ,QFUHDVH <HDVW3URGXFWV,QFUHDVH 7RWDO3URMHFW,QFUHDVH 0D[LPXP(PLVVLRQ,QFUHDVH ZLWKRXW0RGHOLQJ1$ 1$ HAP specific 1$ 0RGHOLQJ5HTXLUHG"1R 1R 1R 1R 1$ 1R 1R 1$ &XUUHQW3HUPLWWHG37( 3RVW3URMHFW37( 0DMRU6RXUFH7KUHVKROG 0DMRU6RXUFH7KUHVKROG([FHHGHG" 1R 1R 1R 1R 1R 1R 1R 1R 1HZDQGPRGLILHGVRXUFHPRGHOLQJWKUHVKROGVDUHSURYLGHGSHU8'$4(PLVVLRQV,PSDFW$VVHVVPHQW*XLGHOLQHV7DEOH 0RGHOLQJWKUHVKROGVDUHVSHFLILFWRWKHHPLVVLRQW\SHZLWKILYHWS\IRUIXJLWLYHHPLVVLRQVDQGWS\IRUQRQIXJLWLYHHPLVVLRQV $SSURYDO2UGHU'$4($1 0DMRUVRXUFHHPLVVLRQWKUHVKROGVDUHGHILQHGE\&)5DLY$GHILQLWLRQRID0DMRUVWDWLRQDU\VRXUFHIRU30DQGLWVSUHFXUVRUV0DMRUVRXUFHHPLVVLRQWKUHVKROGV DUHGHILQHGE\&)5ELEIRU30DQG&2LHSROOXWDQWVIRUZKLFK6DOW/DNH&RXQW\LVLQDWWDLQPHQW7RWDO+$3WKUHVKROGLVJLYHQLQ&)5XQGHUGHILQLWLRQRID0DMRUVRXUFH 7ULQLW\¶VDQDO\VLVRIWKHLQFUHDVHGWKURXJKSXWVDWWKH8WDK%DNHU\LQGLFDWHVWKDWWKHSURMHFW¶VHPLVVLRQLQFUHDVHVDUHEHORZ8'$4PRGHOLQJ WKUHVKROGV7KHUHIRUHPRGHOLQJLVQRWUHTXLUHG 8$&5 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV 121$77$,10(170$,17(1$1&($5($62))6(77,1* 3HU8'$4¶V)RUPIRU12,DQG5DQG5$SSHQGL[)VKRXOGLQFOXGHRIIVHWUHTXLUHPHQWVIRU QRQDWWDLQPHQWDQGPDLQWHQDQFHDUHDV 302IIVHWV 30RIIVHWVDUHDSSOLFDEOHWRPDMRUVRXUFHVORFDWHGZLWKLQRULPSDFWLQJD30QRQDWWDLQPHQWDUHDRIWKH 1$$46$PDMRUVRXUFHLQDVHULRXVQRQDWWDLQPHQWDUHDLVGHILQHGLQ5EDV³DQ\VWDWLRQDU\ VRXUFHRIDLUSROOXWDQWVZKLFKHPLWVRUKDVWKH>37(@>73<@RUPRUHRIGLUHFW30RUDQ\LQGLYLGXDO30 SUHFXUVRUDVGHILQHGLQ5F>LH6212[92&VDQGDPPRQLD@´ 7KH37(LQFUHDVHSUHVHQWHGLQ6HFWLRQGHPRQVWUDWHV3030DQG30SUHFXUVRUVEHORZWKHGHILQHG PDMRUVRXUFHWKUHVKROGVWKHUHIRUHWKH8WDK%DNHU\LVQRWVXEMHFWWRWKHRIIVHWUHTXLUHPHQWVRI5 302IIVHWV 30RIIVHWVDUHDSSOLFDEOHWRQHZPDMRUVRXUFHVWKDWKDYHD37(RUPRGLILHGVRXUFHVZKLFKZRXOG SURGXFHDQHPLVVLRQLQFUHDVHHTXDOWRRUH[FHHGLQJWKHWRQQDJHWRWDORIVXOIXUGLR[LGH62RU12;DV IROORZVDQGWKDWDUHORFDWHGLQRULPSDFWD301RQDWWDLQPHQW$UHD8$&5 ჭ)RUDWRWDORIWS\RUPRUHWKHHVWDEOLVKHGRIIVHWUDWLRRILVUHTXLUHGDQG ჭ)RUDWRWDORIWS\EXWOHVVWKDQWS\WKHHVWDEOLVKHGRIIVHWUDWLRRIRIWKHHPLVVLRQLQFUHDVHLV UHTXLUHG 7KH8WDK%DNHU\¶V37(LQFUHDVHDVSUHVHQWHGLQ6HFWLRQKDVDWRWDOWRQQDJHRIOHVVWKDQWS\IRU62 DQGIRU12;WKHUHIRUHLWLVQRWVXEMHFWWRWKHRIIVHWUHTXLUHPHQWVIRU30 2]RQH2IIVHWV 2]RQH2IIVHWUHTXLUHPHQWVLQWKH8WDK$GPLQLVWUDWLYH&RGH8$&592&RIIVHWVDUHDSSOLFDEOH WRVLJQLILFDQWVRXUFHVORFDWHGZLWKLQRULPSDFWLQJDQR]RQHQRQDWWDLQPHQWDUHDRIWKH1$$46,QVXPPDU\ VLJQLILFDQWVRXUFHVORFDWHGLQ'DYLV&RXQW\RU6DOW/DNH&RXQW\VKDOORIIVHWWKHSURSRVHGLQFUHDVHLQ92& HPLVVLRQVE\DUDWLRRIEHIRUHWKH'LUHFWRUPD\LVVXHDQDSSURYDORUGHUWRFRQVWUXFWPRGLI\RU UHORFDWHXQGHU5 6LJQLILFDQWPHDQVIRUWKHSXUSRVHVRIGHWHUPLQLQJZKDWLVDVLJQLILFDQWHPLVVLRQLQFUHDVHRUDVLJQLILFDQW QHWHPLVVLRQLQFUHDVHDQGWKHUHIRUHDPDMRUPRGLILFDWLRQDUDWHRIHPLVVLRQVWKDWZRXOGHTXDORUH[FHHG DQ\RIWKHIROORZLQJUDWHV IRU92&VWRQVSHU\HDU IRU12;WRQVSHU\HDU 7KH37(LQFUHDVHSUHVHQWHGLQ6HFWLRQLVOHVVWKDQWS\RI92&VWKHUHIRUHR]RQHRIIVHWVGRQRWDSSO\ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV $33/,&$%/(5(*8/$7,216 ,QDFFRUGDQFHZLWK8'$4¶V)RUPWKLV12,DLUSHUPLWDSSOLFDWLRQLQFOXGHVDGLVFXVVLRQRI)HGHUDODQG 6WDWHUHTXLUHPHQWVDQGWKHLUDSSOLFDELOLW\WRWKHSURMHFW7KHUHJXODWLRQVWKDW7ULQLW\UHYLHZHGLQFOXGH 1$$466WDWH,PSOHPHQWDWLRQ3ODQV6,31HZ6RXUFH3HUIRUPDQFH6WDQGDUGV1636DQG1DWLRQDO (PLVVLRQ6WDQGDUGVIRU+D]DUGRXV$LU3ROOXWDQWV1(6+$3DQG8WDK$LU4XDOLW\5HJXODWLRQV *HQHUDO,QWURGXFWLRQ±8WDK5HJXODWLRQV 7ULQLW\HYDOXDWHGWKHDSSOLFDELOLW\RIHDFKUXOHXQGHUWKH8$&7LWOH57KHUXOHVDSSOLFDEOHWRWKH PRGLILFDWLRQRIWKH8WDK%DNHU\¶V$2KDYHEHHQDGGUHVVHGLQWKHWDEOHEHORZ 7DEOH(YDOXDWLRQRI8'$4$LU4XDOLW\5XOHV6SHFLILFWRWKLV0RGLILFDWLRQ 5HIHUHQFH5HJXODWLRQ1DPH$SSOLFDELOLW\ <HV1R 5*HQHUDO5HTXLUHPHQWV ; 5*HQHUDO5HTXLUHPHQWV%URDGO\$SSOLFDEOH 5HTXLUHPHQWV; 5$GPLQLVWUDWLYH3URFHGXUHV ; 5&RQIOLFWRI,QWHUHVW; 5*HQHUDO5HTXLUHPHQWV(PHUJHQF\FRQWUROV ; 5 *HQHUDO5HTXLUHPHQWV%UHDNGRZQV ; 5 *HQHUDO5HTXLUHPHQWV6WDWH,PSOHPHQWDWLRQ 3ODQ; 5*HQHUDO&RQIRUPLW\ ; 5*HQHUDO5HTXLUHPHQWV7D[([HPSWLRQIRU$LU 3ROOXWLRQ&RQWURO(TXLSPHQW; 5*HQHUDO5HTXLUHPHQWV&OHDQ$LUDQG(IILFLHQW 9HKLFOH7D[&UHGLW; 5 *HQHUDO5HTXLUHPHQWV+HDY\'XW\9HKLFOH7D[ &UHGLW; 5 *HQHUDO5HTXLUHPHQWV&OHDQ)XHOVDQG9HKLFOH 7HFKQRORJ\*UDQWDQG/RDQ3URJUDP ; 5*HQHUDO5HTXLUHPHQWV&RQYHUVLRQWR$OWHUQDWLYH )XHO*UDQW3URJUDP ; 5&OHDQ$LU5HWURILW5HSODFHPHQWDQG2II5RDG 7HFKQRORJ\3URJUDP; 5*HQHUDO3HQDOW\3ROLF\; 5 (QIRUFHPHQW3ROLF\IRU$VEHVWRV+D]DUG (PHUJHQF\5HVSRQVH$FW; 5(PLVVLRQ,QYHQWRULHV ; 5 (PLVVLRQ7HVWLQJ ; 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV 5HIHUHQFH5HJXODWLRQ1DPH$SSOLFDELOLW\ <HV1R 5&RQWLQXRXV(PLVVLRQ0RQLWRULQJ3URJUDP; 5(PLVVLRQ6WDQGDUGV*HQHUDO(PLVVLRQ6WDQGDUGV ; 5(PLVVLRQ6WDQGDUGV*HQHUDO%XUQLQJ; 5 (PLVVLRQ6WDQGDUGV6XOIXU&RQWHQWRI)XHOV; 5(PLVVLRQ6WDQGDUGV6PRNH0DQDJHPHQW; 5(PLVVLRQ6WDQGDUGV)XJLWLYH(PLVVLRQVDQG )XJLWLYH'XVW; 5(PLVVLRQ6WDQGDUGV$EUDVLYH%ODVWLQJ; 5 5HVLGHQWLDO)LUHSODFHVDQG6ROLG)XHO%XUQLQJ 'HYLFHV ; 52XWGRRU:RRG%RLOHUV; 56WDQGDUGVRI3HUIRUPDQFHIRU1HZ6WDWLRQDU\ 6RXUFHV; 51DWLRQDO(PLVVLRQ6WDQGDUGVIRU+D]DUGRXV$LU 3ROOXWDQWV; 5(PLVVLRQ6WDQGDUGV3ODQIRU'HVLJQDWHG )DFLOLWLHV; 5 (PLVVLRQ6WDQGDUGV(PLVVLRQ&RQWUROVIRU ([LVWLQJ0XQLFLSDO6ROLG:DVWH/DQGILOOV ; 5 (PLVVLRQ6WDQGDUGV([LVWLQJLQFLQHUDWRUIRU +RVSLWDO0HGLFDO,QIHFWLRXV:DVWH ; 5(PLVVLRQ6WDQGDUGV([LVWLQJ6PDOO0XQLFLSDO :DVWH&RPEXVWLRQ8QLWV; 50HUFXU\(PLVVLRQ6WDQGDUGV&RDO)LUHG(OHFWULF *HQHUDWLQJ8QLWV; 5 12;(PLVVLRQ/LPLWVIRU1DWXUDO*DV)LUHG:DWHU +HDWHUV; 5:HVWHUQ%DFNVWRS6XOIXU'LR[LGH7UDGLQJ 3URJUDP; 5 8WDKDQG:HEHU&RXQWLHV2[\JHQDWHG*DVROLQH 3URJUDPDVD&RQWLQJHQF\0HDVXUH ; 56ROLG)XHO%XUQLQJ'HYLFHV; 5&RPPHUFLDO&RRNLQJ; 5 6ROYHQW&OHDQLQJ ; 5 1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDVIRU30 (PLVVLRQ6WDQGDUGV; 5 301RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV $EUDVLYH%ODVWLQJ ; 5 5RDG6DOWLQJDQG6DQGLQJ; 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV 5HIHUHQFH5HJXODWLRQ1DPH$SSOLFDELOLW\ <HV1R 5 1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDVIRU30 DQG30)XJLWLYH(PLVVLRQVDQG)XJLWLYH'XVW; 5 6DOW/DNH&RXQW\7UDGLQJRI(PLVVLRQ%XGJHWV IRU7UDQVSRUWDWLRQ&RQIRUPLW\ ; 5 8WDK&RXQW\7UDGLQJRI(PLVVLRQ%XGJHWVIRU 7UDQVSRUWDWLRQ&RQIRUPLW\ ; 5 $JJUHJDWH3URFHVVLQJ2SHUDWLRQVIRU30 1RQDWWDLQPHQW$UHDV ; 5 2]RQH0DLQWHQDQFH$UHDVDQG2JGHQ&LW\ (PSOR\HU%DVHG7ULS5HGXFWLRQ ; 52]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV *HQHUDO5HTXLUHPHQWV; 5 2]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV &RQWURORI+\GURFDUERQ(PLVVLRQVLQ3HWUROHXP 5HILQHULHV ; 52]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV 3HWUROHXP/LTXLG6WRUDJH; 5 *DVROLQH7UDQVIHUDQG6WRUDJH ; 5 'HJUHDVLQJ ; 52]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV &XWEDFN$VSKDOW ; 5 $GKHVLYHVDQG6HDODQWV ; 5:RRG)XUQLWXUH0DQXIDFWXULQJ2SHUDWLRQV; 53DSHU)LOPDQG)RLO&RDWLQJV; 5)DEULFDQG9LQ\O&RDWLQJV; 50HWDO)XUQLWXUH6XUIDFH&RDWLQJV; 5/DUJH$SSOLDQFH6XUIDFH&RDWLQJV; 50DJQHW:LUH&RDWLQJV; 5)ODW:RRG3DQHO&RDWLQJ; 50LVF0HWDO3DUWVDQG3URGXFW&RDWLQJ; 5 *UDSKLF$UWV ; 50HWDO&RQWDLQHU&ORVXUHDQG&RLO&RDWLQJV; 53ODVWLF3DUWV&RDWLQJV; 5$XWRPRWLYH5HILQLVKLQJ&RDWLQJV; 5$HURVSDFH0DQXIDFWXUHDQG5HZRUN)DFLOLWLHV; 5$SSOLDQFH3LORW/LJKW; 5&RQVXPHU3URGXFWV; 5$UFKLWHFWXUDO&RDWLQJV ; 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV 5HIHUHQFH5HJXODWLRQ1DPH$SSOLFDELOLW\ <HV1R 53HUPLW1HZDQG0RGLILHG6RXUFHV ; 53HUPLWV1HZDQG0RGLILHG6RXUFHVLQ 1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV; 53HUPLWV0DMRU6RXUFHVLQ$WWDLQPHQWRU 8QFODVVLILHG$UHDV36'; 5 9LVLELOLW\; 5 3HUPLWV(PLVVLRQ,PSDFW$QDO\VLV; 5 3HUPLWV)HHVIRU$SSURYDO2UGHUV ; 5 3HUPLWV2SHUDWLQJ3HUPLW5HTXLUHPHQWV; 5 3HUPLWV$FLG5DLQ6RXUFHV ; 53HUPLWV2]RQH2IIVHW5HTXLUHPHQWVLQ6DOW/DNH &RXQW\DQG8WDK&RXQW\ ; 53HUPLWV302IIVHW5HTXLUHPHQWVLQ6DOW/DNH &RXQW\DQG8WDK&RXQW\; 53HUPLWV0HUFXU\5HTXLUHPHQWVIRU(OHFWULF *HQHUDWLQJ8QLWV; 5WR 2LODQG*DV,QGXVWU\; 5 8WDK$VEHVWRV5XOH ; 5/HDG%DVHG3DLQW3URJUDP3XUSRVH$SSOLFDELOLW\ DQG'HILQLWLRQV; 5 5HVLGHQWLDO3URSHUW\DQG&KLOG2FFXSLHG)DFLOLW\ 5HQRYDWLRQ ; 5/HDG%DVHG3DLQW$FWLYLWLHV; 7KHVXEMHFWUXOHLVDSSOLFDEOHWR86%KRZHYHUWKLVUXOHLVQRWVSHFLILFWRRSHUDWLRQDOFRPSOLDQFH UHTXLUHPHQWVDQGLVWKHUHIRUHQRWGLVFXVVHGLQWKLV12,DLUSHUPLWDSSOLFDWLRQ $SSOLFDEOH1636DQG1(6+$3UHJXODWLRQVDUHGHWDLOHGXQGHUDSSURSULDWHSURMHFWKHDGLQJV 8$&5*HQHUDO5HTXLUHPHQWV%UHDNGRZQV 86%ZLOOUHSRUWEUHDNGRZQVDWWKH8WDK%DNHU\ZLWKLQKRXUVYLDWHOHSKRQHHOHFWURQLFPDLOID[RURWKHU VLPLODUPHWKRGDQGSURYLGHGHWDLOHGZULWWHQGHVFULSWLRQZLWKLQGD\VRIWKHRQVHWRIWKHLQFLGHQWWR8'$4 8$&5 86%ZLOOFRPSO\DQGFRQIRUPWRWKHGHILQLWLRQVWHUPVDEEUHYLDWLRQVDQGUHIHUHQFHVXVHGLQWKH8$&5 DQG&)5 8$&56ROYHQW&OHDQLQJ ,QWKHHYHQWWKDW86%XVHVPRUHWKDQJDOORQVRI92&FRQWDLQLQJVROYHQWSURGXFWVIRUVROYHQWFOHDQLQJ RSHUDWLRQV86%ZLOOFRPSO\ZLWKWKHIROORZLQJ92&FRQWHQWOLPLWVOLVWHGLQWKLVUXOH 6ROYHQW&OHDQLQJ92&/LPLWVH[FOXGLQJZDWHUDQGH[HPSWVROYHQWVIURPWKHGHILQLWLRQRI92&VIRXQGLQ 5 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV 6ROYHQW&OHDQLQJ&DWHJRU\ 92&/LPLW OEJDO J/ 7RROHTXLSPHQWDQGPDFKLQHU\ *HQHUDOVXUIDFHFOHDQLQJ 86%ZLOOVWRUHXVHGDSSOLFDWRUVLQFORVHGILUHSURRIFRQWDLQHUV86%ZLOODOVRPDLQWDLQUHFRUGVRIWKH92& FRQWHQWRUFRPSRVLWHYDSRUSUHVVXUHRIWKHVROYHQWSURGXFWDSSOLHGIRUDWOHDVWWZR\HDUV 8$&51RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDVIRU30(PLVVLRQ 6WDQGDUGV 9LVLEOHHPLVVLRQVIURPH[LVWLQJLQVWDOODWLRQVH[FHSWGLHVHOHQJLQHVVKDOOEHRIDVKDGHRUGHQVLW\QRGDUNHU WKDQRSDFLW\H[FHSWIRUVWDUWLQJPRWLRQQRIDUWKHUWKDQ\DUGVRUIRUVWDWLRQDU\RSHUDWLRQQRW H[FHHGLQJWKUHHPLQXWHVLQDQ\KRXU9LVLEOHHPLVVLRQVVKDOOEHPHDVXUHGXVLQJ(3$0HWKRG 9LVLEOHHPLVVLRQVH[FHHGLQJWKHRSDFLW\VWDQGDUGVIRUVKRUWWLPHSHULRGVDVWKHUHVXOWRILQLWLDOZDUPXS VRRWEORZLQJFOHDQLQJRIJUDWHVEXLOGLQJRIERLOHUILUHVFRROLQJHWFFDXVHGE\VWDUWXSRUVKXWGRZQRID IDFLOLW\LQVWDOODWLRQRURSHUDWLRQRUXQDYRLGDEOHFRPEXVWLRQLUUHJXODULWLHVZKLFKGRQRWH[FHHGWKUHHPLQXWHV LQOHQJWKDUHQRWWREHGHHPHGLQYLRODWLRQSURYLGHGWKDWWKHGLUHFWRUILQGVWKDWDGHTXDWHFRQWUROWHFKQRORJ\ KDVEHHQDSSOLHG7KHRZQHURURSHUDWRUVKDOOPLQLPL]HYLVLEOHDQGQRQYLVLEOHHPLVVLRQVGXULQJVWDUWXSRU VKXWGRZQRIDIDFLOLW\LQVWDOODWLRQRURSHUDWLRQWKURXJKWKHXVHRIDGHTXDWHFRQWUROWHFKQRORJ\DQGSURSHU SURFHGXUHV 7KH8WDK%DNHU\LVORFDWHGLQ6DOW/DNH&RXQW\ZKLFKLVFXUUHQWO\LQQRQDWWDLQPHQWIRU3086%ZLOO FRPSO\ZLWKWKHUHTXLUHPHQWVGHVFULEHGLQ8$&5 8$&51RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDVIRU30DQG30 )XJLWLYH(PLVVLRQVDQG)XJLWLYH'XVW )XJLWLYHHPLVVLRQVIURPDQ\VRXUFHHJPL[HUVVKDOOQRWH[FHHGRSDFLW\2SDFLW\REVHUYDWLRQVRI IXJLWLYHHPLVVLRQVIURPVWDWLRQDU\VRXUFHVVKDOOEHFRQGXFWHGLQDFFRUGDQFHZLWK(3$0HWKRG)RU LQWHUPLWWHQWVRXUFHVWKHUHTXLUHPHQWIRU0HWKRGREVHUYDWLRQVWREHPDGHDWVHFRQGLQWHUYDOVRYHUD VL[PLQXWHSHULRGVKDOOQRWDSSO\7KHQXPEHURIREVHUYDWLRQVDQGWKHWLPHSHULRGVKDOOEHGHWHUPLQHGE\ WKHOHQJWKRIWKHLQWHUPLWWHQWRSHUDWLRQ 8$&52]RQH1RQDWWDLQPHQWDQG0DLQWHQDQFH$UHDV*HQHUDO 5HTXLUHPHQWV 7KH8WDK%DNHU\LVORFDWHGLQWKH1RUWKHUQ:DVDWFK)URQW2]RQH1RQDWWDLQPHQWDUHDDQGSURGXFHV92&VDV SDUWRILWVRSHUDWLRQV7KLVUXOHLVWKHUHIRUHDSSOLFDEOH86%ZLOOHQVXUHWKDW92&VDUHQRWVSLOOHGGLVFDUGHG VWRUHGLQRSHQFRQWDLQHUVRUKDQGOHGLQDQ\RWKHUPDQQHUWKDWZRXOGUHVXOWLQJUHDWHUHYDSRUDWLRQRI92&V WKDQZRXOGKDYHLIUHDVRQDEO\DYDLODEOHFRQWUROWHFKQRORJ\5$&7KDGEHHQDSSOLHG 8$&5$SSURYDO2UGHU 86%¶V12,DLUSHUPLWDSSOLFDWLRQWRPRGLI\LWV$2PHHWVWKHFRQGLWLRQVUHTXLUHGXQGHU5IRU8'$4 WRDSSURYHWKH12,DLUSHUPLWDSSOLFDWLRQEHFDXVH 7KHGHJUHHRISROOXWLRQFRQWUROIRUHPLVVLRQVLQFOXGLQJIRUIXJLWLYHHPLVVLRQVDQGIXJLWLYHGXVWWKDW FDQEHPHWIRUWKHPRGLILHGVRXUFHLVDWOHDVWEHVWDYDLODEOHFRQWUROWHFKQRORJ\ZKHUHDSSOLFDEOH 7KHEHVWDYDLODEOHFRQWUROWHFKQRORJ\IRUDQHZRUPRGLILHGVRXUFHLQDQR]RQHQRQDWWDLQPHQWRU PDLQWHQDQFHDUHDWKDWZLOOHPLWYRODWLOHRUJDQLFFRPSRXQGVRUQLWURJHQR[LGHVWKDWFDQEHPHWIRUWKH 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU 7ULQLW\&RQVXOWDQWV PRGLILHGVRXUFHLVDWOHDVWDVVWULQJHQWDVGHVFULEHGLQDQ\&RQWURO7HFKQLTXH*XLGDQFHGRFXPHQWWKDW KDVEHHQSXEOLVKHGE\(3$DQGWKDWLVDSSOLFDEOHWRWKHDGGHGHTXLSPHQW $OOSROOXWLRQFRQWUROHTXLSPHQWDWWKH8WDK%DNHU\LVSURSHUO\PDLQWDLQHGDVDSSOLFDEOH $SSOLFDEOHSURYLVLRQVRI5RU6,3FDQEHPHWIRUWKHPRGLILHGVRXUFH 7KHPRGLILHGVRXUFHFDQPHHWWKHUHTXLUHPHQWVRIWKH$SSURYHG2UGHU 8$&53HUPLWV)HHVIRU$SSURYDO2UGHUV 86%ZLOOFRPSO\DQGFRQIRUPWRWKHGHILQLWLRQVWHUPVDEEUHYLDWLRQVDQGUHIHUHQFHVXVHGLQWKH8$&5 DQG&)5 )HGHUDO5HJXODWLRQV 7KH8WDK%DNHU\LVQRWVXEMHFWWR16366XESDUW'F6PDOO,QGXVWULDO&RPPHUFLDO,QVWLWXWLRQDO6WHDP *HQHUDWLQJ8QLWVEHFDXVHWKH%DNHU\¶VERLOHUVHDFKKDYHDPD[LPXPGHVLJQKHDWLQSXWRIOHVVWKDQ 00%WXKU7KH8WDK%DNHU\LVDOVRQRWVXEMHFWWR1(6+$36XESDUW------,QGXVWULDO&RPPHUFLDODQG ,QVWLWXWLRQDO%RLOHUV$UHD6RXUFHVEHFDXVHLWVERLOHUVPHHWWKHGHILQLWLRQRID³JDVILUHGXQLW´ 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU$ 7ULQLW\&RQVXOWDQWV $33(1',;$)2506 Form 1 Date __________________ Notice of Intent (NOI) Application Checklist Company __________________ Utah Division of Air Quality New Source Review Section Source Identification Information [R307-401-5] 1. Company name, mailing address, physical address and telephone number 2. Company contact (Name, mailing address, and telephone number) 3. Name and contact of person submitting NOI application (if different than 2) 4. Source Universal Transverse Mercator (UTM) coordinates 5. Source Standard Industrial Classification (SIC) code 6. Area designation (attainment, maintenance, or nonattainment) 7. Federal/State requirement applicability (NAAQS, NSPS, MACT, SIP, etc.) 8. Source size determination (Major, Minor, PSD) 9. Current Approval Order(s) and/or Title V Permit numbers NOI Application Information:[R307-401] N/A N/A A. Air quality analysis (air model, met data, background data, source impact analysis) N/A Detailed description of the project and source process Discussion of fuels, raw materials, and products consumed/produced Description of equipment used in the process and operating schedule Description of changes to the process, production rates, etc. Site plan of source with building dimensions, stack parameters, etc. Best Available Control Technology (BACT) Analysis [R307-401-8] $BACT analysis for all new and modified equipment Emissions Related Information: [R307-401-2(b)] $Emission calculations for each new/modified unit and site-wide (Include PM10, PM2.5,NOx, SO2, CO, VOCs, HAPs, and GHGs) %References/assumptions, SDS, for each calculation and pollutant &All speciated HAP emissions (list in lbs/hr) Emissions Impact Analysis – Approved Modeling Protocol [R307-410] $Composition and physical characteristics of effluent (emission rates, temperature, volume, pollutant types and concentrations) Nonattainment/Maintenance Areas – Major NSR/Minor (offsetting only)[R307-403] $NAAQS demonstration, Lowest Achievable Emission Rate, Offset requirements %Alternative site analysis, Major source ownership compliance certification Major Sources in Attainment or Unclassified Areas (PSD) [R307-405, R307-406] %Visibility impact analysis, Class I area impact 6LJQDWXUHRQ$SSOLFDWLRQ N/A Note: The Division of Air Quality will not accept documents containing confidential information or data. Documents containing confidential information will be returned to the Source submitting the application. August 2023 ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ United States Bakery $2 Form 4 Company____________________________ Project Information Site ______________________________ Utah Division of Air Quality New Source Review Section Process Data -For Modification/Amendment ONLY 1. Permit Number_______________________________ If submitting a new permit, then use Form 3 Requested Changes 2. Name of process to be modified/added: _______________________________ End product of this process: 3. Permit Change Type: New Increase* Equipment Process Condition Change ____________________ Other ______________________________ Other ______________________________ Other ______________________________ 4. Does new emission unit affect existing permitted process limits? Yes No 5. Condition(s) Changing: 6. Description of Permit/Process Change** 7. New or modified materials and quantities used in process. ** Material Quantity Annually 8. New or modified process emitting units ** Emitting Unit(s) Capacity(s) Manufacture Date(s) *If the permit being modified does not include CO2e or PM2.5, the emissions need to be calculated and submitted to DAQ, which may result in an emissions increase and a public comment period. **If additional space is required, please generate a document to accommodate and attach to form. United States Bakery Utah Bakery DAQE-AN147800002-20 Increasing production of baked goods Modification will result in increase of bread and buns. As a whole, the Utah Bakery produces bread, buns, cookies, muffins, doughnuts. ✔ Throughput and emission limits. Increase in bread and buns throughput. See NOI Air Permit Application See NOI Air Permit Application $4 Company___________________________ 6LWH_____________________________ Form Emissions Information Criteria/GHGs/ HAP’s Utah Division of Air Quality New Source Review Section Potential to Emit* Criteria Pollutants & GHGs Criteria Pollutants Permitted Emissions (tons/yr) Emissions Increases (tons/yr) Proposed Emissions (tons/yr) PM10 Total PM10 Fugitive PM2.5 NOx SO2 CO VOC VOC Fugitive NH3 Greenhouse Gases CO2e CO2e CO2e CO2 CH4 N2O HFCs PFCs SF6 Total CO2e *Potential to emit to include pollution control equipment as defined by R307-401-2. Hazardous Air Pollutants**(**Defined in Section 112(b) of the Clean Air Act ) Hazardous Air Pollutant*** Permitted Emissions (tons/yr) Emission Increase (tons/yr) Proposed Emission (tons/yr) Emission Increase (lbs/hr) Total HAP *** Use additional sheets for pollutants if needed 4FF"UUBDIFEGPS &NJTTJPO*OGPSNBUJPO 4FF"UUBDIFEGPS &NJTTJPO*OGPSNBUJPO 4FF"UUBDIFEGPS &NJTTJPO*OGPSNBUJPO US Bakery Utah Bakery $5 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU% 7ULQLW\&RQVXOWDQWV $33(1',;%(0,66,216&$/&8/$7,216 8QLWHG6WDWHV%DNHU\1RWLFHRI,QWHQW$LU3HUPLW$SSOLFDWLRQ $SSHQGL[%(PLVVLRQ&DOFXODWLRQV7DEOHV 7DEOH%6LOR7KURXJKSXW,QSXWV 6LOR 6LOR 7DEOH%3URGXFW7KURXJKSXW,QFUHDVH %UHDG %XQV 3URGXFW+RXUO\7KURXJKSXW ,QFUHDVHOEKU $QQXDO7KURXJKSXW ,QFUHDVHWS\ 2SHUDWLQJ +RXUV<HDU ,QFUHDVHLQ $QQXDO7RQV /RDGHGWS\ 6WRUDJH&DSDFLW\ WRQV /RDGVSHU :HHN 3RXQGVSHU /RDG(TXLSPHQW 86%12,(PLVVLRQ&DOFXODWLRQV 8WDK%DNHU\ $XJXVW 7ULQLW\&RQVXOWDQWV,QF%2 8QLWHG6WDWHV%DNHU\1RWLFHRI,QWHQW$LU3HUPLW$SSOLFDWLRQ $SSHQGL[%(PLVVLRQ&DOFXODWLRQV7DEOHV 7DEOH%3URMHFWHG)DFLOLW\ZLGH(PLVVLRQV6XPPDU\ 30306212;92& &2 7RWDO+$3V &2H 0DWHULDO+DQGOLQJ,QFUHDVH <HDVW3URGXFWV,QFUHDVH 7RWDO3URMHFW,QFUHDVH 0D[LPXP(PLVVLRQ,QFUHDVHZLWKRXW0RGHOLQJ 1$ 1$ HAPs specific 1$ 0RGHOLQJ5HTXLUHG"1R 1R 1R 1R 1$ 1R 1R 1$ &XUUHQW3HUPLWWHG37( 1HZ37( 0DMRU6RXUFH7KUHVKROG 0DMRU6RXUFH7KUHVKROG([FHHGHG"1R 1R 1R 1R 1R 1R 1R 1R (PLVVLRQ3RLQW 37((PLVVLRQ5DWH WS\ 1HZDQGPRGLILHGVRXUFHPRGHOLQJWKUHVKROGVDUHSURYLGHGSHU8'$4(PLVVLRQV,PSDFW$VVHVVPHQW*XLGHOLQHV7DEOH0RGHOLQJWKUHVKROGVDUHVSHFLILFWRWKHHPLVVLRQW\SH ZLWKILYHWS\IRUIXJLWLYHHPLVVLRQVDQGWS\IRUQRQIXJLWLYHHPLVVLRQV 0DMRUVRXUFHHPLVVLRQWKUHVKROGVDUHGHILQHGE\&)5DLY$GHILQLWLRQRID0DMRUVWDWLRQDU\VRXUFHIRU30DQGLWVSUHFXUVRUV0DMRUVRXUFHHPLVVLRQ WKUHVKROGVDUHGHILQHGE\&)5ELEIRU30DQG&2LHSROOXWDQWVIRUZKLFK6DOW/DNH&RXQW\LVLQDWWDLQPHQW7RWDO+$3WKUHVKROGLVJLYHQLQ&)5 XQGHUGHILQLWLRQRID0DMRUVRXUFH $SSURYDO2UGHU'$4($1 86%12,(PLVVLRQ&DOFXODWLRQV 8WDK%DNHU\ $XJXVW 7ULQLW\&RQVXOWDQWV,QF %3 8QLWHG6WDWHV%DNHU\1RWLFHRI,QWHQW$LU3HUPLW$SSOLFDWLRQ $SSHQGL[%(PLVVLRQ&DOFXODWLRQV7DEOHV 6LOR 6LOR (TXLSPHQW&DSDFLW\ OEKU $QQXDO 7KURXJKSXW ,QFUHDVHWS\ 0L[HU 0L[HU 3DUDPHWHU 30OEWRQ 30OEWRQ30 OEWRQ /RDGLQJ8QORDGLQJ( ( ( 0L[HUV( ( ( (TXLSPHQW 30OEKU 30OEKU30 OEKU30WS\30WS\ 30WS\ 6LOR( ( ( ( ( ( 6LOR( ( ( ( ( ( 0L[HU( ( ( ( ( ( 0L[HU( ( ( ( ( ( ,QFUHDVHLQ0DWHULDO +DQGOLQJ(PLVVLRQV ( ( ( ( ( 7DEOH%)ORXU8VDJH3DUDPHWHUV 7DEOH%0DWHULDO+DQGOLQJ&RQWUROOHG(PLVVLRQ)DFWRUV 7DEOH%(PLVVLRQV,QFUHDVHIURP0DWHULDO+DQGOLQJ 7RWDODQQXDOHPLVVLRQVDUHFDOFXODWHGDVIROORZV 7RWDO(PLVVLRQVWS\ (PLVVLRQ)DFWRUOEVWRQî$QQXDO/RDGLQJ4XDQWLW\WS\îWRQOEVî :KHUHXQORDGLQJHPLVVLRQVDUHLQFRUSRUDWHGE\PXOWLSO\LQJE\WZR (TXLSPHQW $QQXDO 7KURXJKSXW ,QFUHDVHWS\ 7RWDO6WRUDJH &DSDFLW\WRQV 0D[LPXP+RXUO\ORDGLQJHPLVVLRQVDUHFRQVHUYDWLYHO\HVWLPDWHGZLWKRQHORDGLQJXQORDGLQJRSHUDWLRQRFFXULQJSHUKRXU1RWDEO\86%DNHU\DQWLFLSDWHV WZRORDGLQJVZHHNO\IRU6LOR /RDGLQJXQORDGLQJHPLVVLRQIDFWRUVSHU86(3$$36HFWLRQFRQFUHWHIRUFHPHQWVXSSOHPHQW WRHOHYDWHGVWRUDJHVLOR $OOVLORVHPLVVLRQVDUHURXWHGWRDEDJKRXVH7\SLFDOEDJKRXVHHIILFLHQFLHVUDQJHIURP +RZHYHULWLVFRQVHUYDWLYHO\HVWLPDWHGWKDWHPLVVLRQVUHODWLYHWRVLORORDGLQJXQORDGLQJDUHXQFRQWUROOHG 0L[HUHPLVVLRQIDFWRUVSHU86(3$$36HFWLRQ :KHUH30DQGRU30DUHQRWVSHFLILHGLWLVFRQVHUYDWLYHO\HVWLPDWHGWKDW30 30 30 86%12,(PLVVLRQ&DOFXODWLRQV 8WDK%DNHU\ $XJXVW 7ULQLW\&RQVXOWDQWV,QF %4 8QLWHG6WDWHV%DNHU\1RWLFHRI,QWHQW$LU3HUPLW$SSOLFDWLRQ $SSHQGL[%(PLVVLRQ&DOFXODWLRQV7DEOHV (PLVVLRQ6RXUFH 'RXJK 7KURXJKSXW ,QFUHDVH OEKU 'RXJK 7KURXJKSXW ,QFUHDVH WS\ %DNHU V3HUFHQW RI<HDVW 7RWDO<HDVW $FWLRQ7LPH KUV 92&(PLVVLRQ )DFWRU OEWRQ 92& (PLVVLRQV OEKU 92& (PLVVLRQV WS\ <HDVW)HUPHQWDWLRQ%UHDG <HDVW)HUPHQWDWLRQ%XQV ,QFUHDVHLQ$QQXDO92&(PLVVLRQVIURP<HDVWWS\ 92&HPLVVLRQIDFWRUVDVVRFLDWHGZLWKIHUPHQWDWLRQDUHFDOFXODWHGXVLQJWKHIROORZLQJHTXDWLRQSHU$OWHUQDWLYH&RQWURO7HFKQRORJ\'RFXPHQWIRU%DNHU\2YHQ(PLVVLRQV(3$5 'HFHPEHU(PLVVLRQ)DFWRUOEWRQ п%DNHU V3HUFHQWRI<HDVWî7RWDO<HDVW$FWLRQ7LPHKUV 7DEOH%3URMHFWHG,QFUHDVHLQ<HDVW)HUPHQWDWLRQ(PLVVLRQV +RXUO\DQG$QQXDO92&HPLVVLRQVZHUHFDOFXODWHGXVLQJWKHIROORZLQJHTXDWLRQV +RXUO\(PLVVLRQVOEKU 'RXJK7KURXJKSXWOEKUîWRQOEVî(PLVVLRQ)DFWRUOEWRQ $QQXDO(PLVVLRQVWS\ 'RXJK7KURXJKSXWWS\î(PLVVLRQ)DFWRUOEWRQîWRQOEV <HDVWDFWLRQWLPHGRHVQRWLQFOXGHUHWDUGWLPHZKHQ\HDVWLVQRWH[SHFWHGWREHDFWLYH 86%12,(PLVVLRQ&DOFXODWLRQV 8WDK%DNHU\ $XJXVW 7ULQLW\&RQVXOWDQWV,QF %5 86%DNHU\_12,0RGLILFDWLRQWR$SSURYDO2UGHU& 7ULQLW\&RQVXOWDQWV $33(1',;&%$&7(&2120,&$1$/<6,6 $SSHQGL[&(FRQRPLF)HDVLELOLW\$QDO\VLV %$&7&21752/&267(9$/8$7,21 &OLHQW1DPH 8QLWHG6WDWHV%DNHU\7HFKQRORJ\5HJHQHUDWLYH7KHUPDO2[LGL]HU $GGUHVV 6RXWK:HVW $SSOLFDWLRQ%DNHU\ &LW\6WDWH :HVW-RUGDQ87 3ROOXWDQWV9RODWLOH2UJDQLF&RPSRXQGV92&V 3HUPLW,'1R'$4($1 5HJHQHUDWLYH7KHUPDO2[LGL]HU 6FHQDULR1RWHV 3URFHVV,QIRUPDWLRQ 8QFRQWUROOHG(PLVVLRQVWS\ ([KDXVW$LUIORZVFIP 3HU3XJHW6RXQG&OHDQ$LU$JHQF\ 3HUPLWWR&RQVWUXFWDQG 6&$40'3HUPLWWR&RQVWUXFW &DSWXUH(IILFLHQF\,QGXVWU\VWDQGDUGIRUFORVHGV\VWHP &RQWURO(IILFLHQF\3HU(3$) (OHFWULFDO&RQVXPSWLRQN:K\HDU *DV&RQVXPSWLRQ00%WX\HDU :DWHU&RQVXPSWLRQ0JDO\HDU 8WLOLW\&RVWV (OHFWULFLW\N:K$YHUDJH8WDK3ULFHV)HE 1DWXUDO*DV00%WX$YHUDJH8WDK3ULFHV)HE :DWHU0JDO6DQG\8WDK0HWHU-XO\ /DERU&RVWV 2SHUDWRUKRXU3HU(3$$LU3ROOXWLRQ&RQWURO&RVW 0DQXDO &KDSWHU 6XSHUYLVRUKRXU 3HU(3$$LU3ROOXWLRQ&RQWURO&RVW 0DQXDO &KDSWHU 0DLQWHQDQFHKRXU 3HU(3$$LU3ROOXWLRQ&RQWURO&RVW 0DQXDO &KDSWHU (FRQRPLF)DFWRUV 'ROODU,QIODWLRQWR86&RQVXPHU3ULFH,QGH[ (TXLSPHQW/LIH([SHFWDQF\<HDUV 3HU(3$$LU3ROOXWLRQ&RQWURO&RVW 0DQXDO&KDSWHU7DEOH ,QWHUHVW5DWH &XUUHQW$YJ6%$/RDQ5DWHV$SULO &DSLWDO5HFRYHU\)DFWRU&5) .H\$VVXPSWLRQV 86%DNHU\ 1RWLFHRI,QWHQW$LU3HUPLW$SSOLFDWLRQ $XJXVW 7ULQLW\&RQVXOWDQWV,QF&2 $SSHQGL[&(FRQRPLF)HDVLELOLW\$QDO\VLV ',5(&7&2676 6FHQDULR1RWHV 3XUFKDVHG(TXLSPHQW&RVWV 7RWDO(TXLSPHQW&RVW$ ,QVWUXPHQWDWLRQ î$ 6DOHV7D[î$ )UHLJKW î$ 7RWDO3XUFKDVHG(TXLSPHQW&RVWV % î$ 'LUHFW,QVWDOODWLRQ&RVWV )RXQGDWLRQVDQG6XSSRUWV î% +DQGOLQJDQG(UHFWLRQ î% (OHFWULFDO î% 3LSLQJ î% ,QVXODWLRQ î% 3DLQWLQJ î% 6LWH3UHSDUDWLRQ %XLOGLQJV 1RHVWLPDWH6LWHVSHFLILF $GGLWLRQDOGXFWZRUN1RHVWLPDWH6LWHVSHFLILF 7RWDO'LUHFW,QVWDOODWLRQ&RVWV & î% ,QGLUHFW,QVWDOODWLRQ&RVWV (QJLQHHULQJ î% &RQVWUXFWLRQDQG)LHOG([SHQVH î% &RQWUDFWRU)HHV î% 6WDUWXS î% 3HUIRUPDQFH7HVW î% 3URFHVV&RQWLQJHQFLHV î% 7RWDO,QGLUHFW,QVWDOODWLRQ&RVWV ' î% 7RWDO&DSLWDO,QYHVWPHQW7&, %&' $118$/&2676 6FHQDULR 1RWHV 'LUHFW$QQXDO&RVWV 2SHUDWLQJ/DERUKUSHUKUVKLIW ( 6XSHUYLVRU\/DERURSHUDWLQJODERU ) î( 0DLQWHQDQFH/DERUKUSHUKUVKLIW * 0DLQWHQDQFH0DWHULDOV + * (OHFWULFLW\, 1DWXUDO*DV - :DWHU. 7RWDO'LUHFW$QQXDO&RVWV '$& ()*+,-. ,QGLUHFW$QQXDO&RVWV 2YHUKHDG 0 î()*+ $GPLQLVWUDWLYH&KDUJHV 1 î7&, 3URSHUW\7D[2 î7&, ,QVXUDQFH 3 î7&, &DSLWDO5HFRYHU\4 7RWDO,QGLUHFW$QQXDO&RVWV ,'$& ./01234 7RWDO$QQXDO&RVW7$& '$&,'$& 3ROOXWDQW5HPRYHGWS\ &RVWSHUWRQRI3ROOXWDQW5HPRYHGWRQ 7$&3ROOXWDQW5HPRYHG 86(3$2$436(3$$LU3ROOXWLRQ&RQWURO&RVW0DQXDOWK(GLWLRQ-DQXDU\6HFWLRQ&KDSWHU7DEOH 86(3$2$436(3$$LU3ROOXWLRQ&RQWURO&RVW0DQXDOWK(GLWLRQ-DQXDU\6HFWLRQ&KDSWHU7DEOH 86(3$2$436(3$$LU3ROOXWLRQ&RQWURO&RVW0DQXDOWK(GLWLRQ-DQXDU\6HFWLRQ&KDSWHU(TXDWLRQ 1RWHWKDWWKLVLVWKHHVWLPDWHGPLQLPXPFRVWRIFRQWUROYDULRXVRWKHUFRVWVKDYHQRWEHHQLQFOXGHGLQRUGHUWRSUHVHQWDFRQVHUYDWLYHFRVW DQDO\VLV &DSLWDO5HFRYHU\IDFWRUFDOFXODWHGEDVHGRQ(TXDWLRQD6HFWLRQ&KDSWHUSDJHDQG7DEOH6HFWLRQ&KDSWHUSDJH RI86(3$2$436(3$$LU3ROOXWLRQ&RQWURO&RVW0DQXDOWK(GLWLRQ-DQXDU\ 2SHUDWLQJ&RVW &DSLWDO&RVW 86%DNHU\ 1RWLFHRI,QWHQW$LU3HUPLW$SSOLFDWLRQ $XJXVW 7ULQLW\&RQVXOWDQWV,QF &3 $SSHQGL[&(FRQRPLF)HDVLELOLW\$QDO\VLV %$&7&21752/&267(9$/8$7,21 &OLHQW1DPH8QLWHG6WDWHV%DNHU\7HFKQRORJ\&DWDO\WLF2[LGL]HU $GUHVV 6RXWK:HVW $SSOLFDWLRQ%DNHU\ &LW\6WDWH :HVW-RUGDQ87 3ROOXWDQWV9RODWLOH2UJDQLF&RPSRXQGV92&V 3HUPLW,'1 '$4($1 &DWDO\WLF2[LGL]HU 6FHQDULR1RWHV 3URFHVV,QIRUPDWLRQ 8QFRQWUROOHG(PLVVLRQVWS\ ([KDXVW$LUIORZVFIP 3HU3XJHW6RXQG&OHDQ$LU$JHQF\ 3HUPLWWR&RQVWUXFWDQG 6&$40'3HUPLWWR&RQVWUXFW &DSWXUH(IILFLHQF\ ,QGXVWU\VWDQGDUGIRUFORVHGV\VWHP &RQWURO(IILFLHQF\ 3HU(3$) (OHFWULFDO&RQVXPSWLRQN:K\HDU *DV&RQVXPSWLRQ00%WX\HDU 3HU3XJHW6RXQG&OHDQ$LU$JHQF\ :DWHU&RQVXPSWLRQ0JDO\HDU 8WLOLW\&RVWV (OHFWULFLW\N:K$YHUDJH8WDK3ULFHV)HE 1DWXUDO*DV00%WX$YHUDJH863ULFHV)HE :DWHU0JDO 6DQG\8WDK0HWHU-XO\ /DERU&RVWV 2SHUDWRUKRXU3HU(3$$LU3ROOXWLRQ&RQWURO&RVW 0DQXDO &KDSWHU 6XSHUYLVRUKRXU 3HU(3$$LU3ROOXWLRQ&RQWURO&RVW 0DQXDO &KDSWHU 0DLQWHQDQFHKRXU 3HU(3$$LU3ROOXWLRQ&RQWURO&RVW 0DQXDO &KDSWHU (FRQRPLF)DFWRUV 'ROODU,QIODWLRQWR 86&RQVXPHU3ULFH,QGH[ (TXLSPHQW/LIH([SHFWDQF\<HDUV 3HU(3$$LU3ROOXWLRQ&RQWURO&RVW 0DQXDO&KDSWHU7DEOH ,QWHUHVW5DWH &XUUHQW$YJ6%$/RDQ5DWH$SULO &DSLWDO5HFRYHU\)DFWRU&5) .H\$VVXPSWLRQV 86%DNHU\ 1RWLFHRI,QWHQW$LU3HUPLW$SSOLFDWLRQ $XJXVW 7ULQLW\&RQVXOWDQWV,QF &4 $SSHQGL[&(FRQRPLF)HDVLELOLW\$QDO\VLV ',5(&7&2676 6FHQDULR 1RWHV 3XUFKDVHG(TXLSPHQW&RVWV 7RWDO(TXLSPHQW&RVW$ ,QVWUXPHQWDWLRQ î$ 6DOHV7D[î$ )UHLJKW î$ 7RWDO3XUFKDVHG(TXLSPHQW&RVWV % î$ 'LUHFW,QVWDOODWLRQ&RVWV )RXQGDWLRQVDQG6XSSRUWV î% +DQGOLQJDQG(UHFWLRQ î% (OHFWULFDO î% 3LSLQJ î% ,QVXODWLRQ î% 3DLQWLQJ î% 6LWH3UHSDUDWLRQ %XLOGLQJV 1RHVWLPDWH6LWHVSHFLILF $GGLWLRQDOGXFWZRUN1RHVWLPDWH6LWHVSHFLILF 7RWDO'LUHFW,QVWDOODWLRQ&RVWV & î% ,QGLUHFW,QVWDOODWLRQ&RVWV (QJLQHHULQJ î% &RQVWUXFWLRQDQG)LHOG([SHQVH î% &RQWUDFWRU)HHV î% 6WDUWXS î% 3HUIRUPDQFH7HVW î% 3URFHVV&RQWLQJHQFLHV î% 7RWDO,QGLUHFW,QVWDOODWLRQ&RVWV ' î% 7RWDO&DSLWDO,QYHVWPHQW7&, %&' $118$/&2676 6FHQDULR 1RWHV 'LUHFW$QQXDO&RVWV 2SHUDWLQJ/DERUKUSHUKUVKLIW( 6XSHUYLVRU\/DERURSHUDWLQJODERU) î( 0DLQWHQDQFH/DERUKUSHUKUVKLIW* 0DLQWHQDQFH0DWHULDOV + * (OHFWULFLW\, 1DWXUDO*DV - :DWHU. &DWDO\VW5HSODFHPHQW&RVWV[&5)\HDUV/ 7RWDO'LUHFW$QQXDO&RVWV '$& ()*+,-./ ,QGLUHFW$QQXDO&RVWV 2YHUKHDG 0 î()*+ $GPLQLVWUDWLYH&KDUJHV 1 î7&, 3URSHUW\7D[2 î7&, ,QVXUDQFH 3 î7&, &DSLWDO5HFRYHU\4 7RWDO,QGLUHFW$QQXDO&RVWV ,'$& 01234 7RWDO$QQXDO&RVW7$& '$&,'$& 3ROOXWDQW5HPRYHGWS\ &RVWSHUWRQRI3ROOXWDQW5HPRYHGWRQ 7$&3ROOXWDQW5HPRYHG 86(3$2$436(3$$LU3ROOXWLRQ&RQWURO&RVW0DQXDOWK(GLWLRQ-DQXDU\6HFWLRQ&KDSWHU7DEOH 86(3$2$436(3$$LU3ROOXWLRQ&RQWURO&RVW0DQXDOWK(GLWLRQ-DQXDU\6HFWLRQ&KDSWHU7DEOH &DSLWDO&RVW 2SHUDWLQJ&RVW 86(3$2$436(3$$LU3ROOXWLRQ&RQWURO&RVW0DQXDOWK(GLWLRQ-DQXDU\6HFWLRQ&KDSWHU(TXDWLRQ 1RWHWKDWWKLVLVWKHHVWLPDWHGPLQLPXPFRVWRIFRQWUROYDULRXVRWKHUFRVWVKDYHQRWEHHQLQFOXGHGLQRUGHUWRSUHVHQWDFRQVHUYDWLYHFRVW DQDO\VLV &DSLWDO5HFRYHU\IDFWRUFDOFXODWHGEDVHGRQ(TXDWLRQD6HFWLRQ&KDSWHUSDJHDQG7DEOH6HFWLRQ&KDSWHUSDJH RI86(3$2$436(3$$LU3ROOXWLRQ&RQWURO&RVW0DQXDOWK(GLWLRQ-DQXDU\ 86%DNHU\ 1RWLFHRI,QWHQW$LU3HUPLW$SSOLFDWLRQ $XJXVW 7ULQLW\&RQVXOWDQWV,QF&5